KEGG   Ciona intestinalis (sea squirt): 100185541Help
Entry
100185541         CDS       T01056                                 

Definition
insulin receptor substrate 1-like
Orthology
K16172  
insulin receptor substrate 1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100185541
   04150 mTOR signaling pathway
    100185541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MAPEPDYSAMSTDIVLKGTLRKAKTWNKRFFVLRDGNPPKLEYYENERKWKVNKPKRQIS
LGNPWNIDKKKDTKHEFLIVIFTKDEYFTMAAESADVQQTWISALLKTVRPAAGLTMFKY
IWQVVLENKELEMSSSNLSLHGQHRICLTHDSMVFVACNDRCNNTPAEILITNIRLCGHK
ENMFFIEPGRASGIGNGKLWMDVGDDAMAAQMHTTILNVMYALRQEEASCSYRGRSNSSG
SNSSRTRTTRTHHNPPPSQIGMGKISSAKRNRCDSLPASHVVGLQDSRLRTGSEGENTMK
RPLRYNSMRLTYGSTSPGMRNRLTPTYKRMSQHHVSHSHTSSLPGSCNSSSTASSTEHIN
HDFSSGYMSSSITCSAHTSEPTSADEYGSNSPTQTYIRKQQSSRSIADTQTACTPPIQED
GGYCPTCSHTFHPRHGTAPPPLTLNPPLTPSPTNIPMYPHTHAHIHLMII
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctccagaaccagattattcagctatgtcgacggacattgtgttgaaaggaacactt
cgaaaagctaaaacttggaataaaagattctttgtattaagagatggcaaccctccaaaa
cttgaatattatgaaaacgaacgcaaatggaaagttaacaaaccaaagcgacaaataagt
ttgggcaacccttggaatatcgataaaaagaaagatacaaaacacgaattcttaatcgtt
atattcacgaaagatgaatattttacaatggcagcagaaagcgcagacgttcaacaaact
tggatctctgctttgcttaaaactgtccggcctgctgctggtttgacaatgttcaaatac
atctggcaagttgtgttggagaacaaagaacttgaaatgagcagcagcaaccttagttta
cacggccaacatcgtatttgtctcactcatgactctatggtgttcgtggcttgcaatgat
cgctgtaataatacacctgccgagattcttattactaacataaggttgtgtgggcacaaa
gagaacatgttcttcatcgaaccagggcgtgcgtcaggcatcgggaacggaaagttatgg
atggacgttggcgacgacgccatggctgcacagatgcacaccacgatacttaacgttatg
tacgcgcttcgacaggaagaagcaagttgcagttacaggggaagatccaatagttcaggt
tcaaactcaagtcggacacgaacaacacgtacccaccataacccaccacccagccagata
gggatgggcaaaatttcatcggctaaacgtaatcgatgtgacagcttgcctgcctcccat
gttgttgggttgcaagattcaaggttacgcacaggtagcgagggtgagaacacgatgaaa
cgaccactaagatacaacagtatgcgactcacttatggttcaacaagtcctggtatgagg
aatcgattaacaccgacgtacaaacgtatgagtcaacatcacgtctcacattcacataca
tcatccttgcctggcagttgcaacagctcaagcacagcgtcaagcaccgaacatatcaac
catgacttttcatctggttacatgagtagttctatcacatgctccgcgcatacaagcgaa
ccaacatctgctgatgaatatgggagtaacagtccaacccagacttatatacgtaagcaa
caatctagtcgcagcattgctgatacacaaacagcatgtaccccacccatacaagaggat
gggggttactgccccacctgctcgcatacattccacccccgacacggtacagccccccca
cccctgacactcaacccccctctaaccccctcacccacgaatataccaatgtacccacac
actcacgcacacattcacttgatgataatttaa

DBGET integrated database retrieval system