KEGG   Ciona intestinalis (sea squirt): 100185541Help
Entry
100185541         CDS       T01056                                 

Definition
(RefSeq) insulin receptor substrate 1-like
  KO
K16172  
insulin receptor substrate 1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
mTOR signaling pathway
Insulin resistance
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100185541
   04150 mTOR signaling pathway
    100185541
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100185541
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 470 aa AA seqDB search
MAPEPDYSAMSTDIVLKGTLRKAKTWNKRFFVLRDGNPPKLEYYENERKWKVNKPKRQIS
LGNPWNIDKKKDTKHEFLIVIFTKDEYFTMAAESADVQQTWISALLKTVRPAAGLTMFKY
IWQVVLENKELEMSSSNLSLHGQHRICLTHDSMVFVACNDRCNNTPAEILITNIRLCGHK
ENMFFIEPGRASGIGNGKLWMDVGDDAMAAQMHTTILNVMYALRQEEASCSYRGRSNSSG
SNSSRTRTTRTHHNPPPSQIGMGKISSAKRNRCDSLPASHVVGLQDSRLRTGSEGENTMK
RPLRYNSMRLTYGSTSPGMRNRLTPTYKRMSQHHVSHSHTSSLPGSCNSSSTASSTEHIN
HDFSSGYMSSSITCSAHTSEPTSADEYGSNSPTQTYIRKQQSSRSIADTQTACTPPIQED
GGYCPTCSHTFHPRHGTAPPPLTLNPPLTPSPTNIPMYPHTHAHIHLMII
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atggctccagaaccagattattcagctatgtcgacggacattgtgttgaaaggaacactt
cgaaaagctaaaacttggaataaaagattctttgtattaagagatggcaaccctccaaaa
cttgaatattatgaaaacgaacgcaaatggaaagttaacaaaccaaagcgacaaataagt
ttgggcaacccttggaatatcgataaaaagaaagatacaaaacacgaattcttaatcgtt
atattcacgaaagatgaatattttacaatggcagcagaaagcgcagacgttcaacaaact
tggatctctgctttgcttaaaactgtccggcctgctgctggtttgacaatgttcaaatac
atctggcaagttgtgttggagaacaaagaacttgaaatgagcagcagcaaccttagttta
cacggccaacatcgtatttgtctcactcatgactctatggtgttcgtggcttgcaatgat
cgctgtaataatacacctgccgagattcttattactaacataaggttgtgtgggcacaaa
gagaacatgttcttcatcgaaccagggcgtgcgtcaggcatcgggaacggaaagttatgg
atggacgttggcgacgacgccatggctgcacagatgcacaccacgatacttaacgttatg
tacgcgcttcgacaggaagaagcaagttgcagttacaggggaagatccaatagttcaggt
tcaaactcaagtcggacacgaacaacacgtacccaccataacccaccacccagccagata
gggatgggcaaaatttcatcggctaaacgtaatcgatgtgacagcttgcctgcctcccat
gttgttgggttgcaagattcaaggttacgcacaggtagcgagggtgagaacacgatgaaa
cgaccactaagatacaacagtatgcgactcacttatggttcaacaagtcctggtatgagg
aatcgattaacaccgacgtacaaacgtatgagtcaacatcacgtctcacattcacataca
tcatccttgcctggcagttgcaacagctcaagcacagcgtcaagcaccgaacatatcaac
catgacttttcatctggttacatgagtagttctatcacatgctccgcgcatacaagcgaa
ccaacatctgctgatgaatatgggagtaacagtccaacccagacttatatacgtaagcaa
caatctagtcgcagcattgctgatacacaaacagcatgtaccccacccatacaagaggat
gggggttactgccccacctgctcgcatacattccacccccgacacggtacagccccccca
cccctgacactcaacccccctctaaccccctcacccacgaatataccaatgtacccacac
actcacgcacacattcacttgatgataatttaa

DBGET integrated database retrieval system