KEGG   Ciona intestinalis (sea squirt): 100185641Help
Entry
100185641         CDS       T01056                                 

Definition
acyl-CoA desaturase-like
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100185641
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    100185641
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     100185641
Lipid biosynthesis proteins [BR:cin01004]
 Desaturase
  First
   100185641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 372 aa AA seqDB search
MALLFCVIRLAVPYPVQHPVKLWATVVFINCIRYTVFLYCSVCLDIDRDSLAHIKVQHTN
IPGKPHAKFCIKLKDTMRAVSSFLHQIQWFNFAILFSVVCCGLYGFTLVFQVKLLTLIWT
FVCAFISGLGVTAGVHRYWCHRSYKATFSLRALLCFLQTLAIQNSILNWATNHRVHHKFS
ETDADPHNANRGFVFSHIGWIVMKEHPSVDEKRNIMDVSDLLEDKVVAFQHRYYGILVLL
IGVMFPTLVPVLFWGESFTFAFFLNMSRYCVLLNSVSMINSVAHIWGYRPYDDTIGPAEN
SICAFAAMGEGYHNYHHVFPHDYRTSELGMKLNITASFIDMMEKLGLAYDLRTMSNEVIT
ERKRKNLLRKEQ
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcattgttattttgtgttattcggctagcagtgccttatccggtacagcatccggtt
aaactgtgggcaacagtcgtatttataaactgcattcgttacactgtgtttttgtattgc
agtgtttgtctggatattgacagagacagtctagcgcatatcaaagtacaacacactaat
attccaggaaaaccacatgcaaagttctgcatcaagttaaaagacacaatgagagctgtt
tcatctttcttgcaccaaatacagtggtttaacttcgctatattattcagtgttgtatgt
tgtggcttgtatggattcacgctggtgtttcaagtaaaactgctcactttaatatggaca
tttgtgtgtgcattcattagtggtcttggtgtaacagcaggtgtacacagatattggtgt
catagatcgtataaagcaacattttcacttagagctttgctatgcttcctgcaaacactg
gcgatacagaacagtatattaaactgggccacgaaccacagggttcatcacaagttctcg
gagacggacgccgacccacataacgccaacaggggctttgtgttcagtcatattggctgg
attgtaatgaaggaacatccatctgtggatgagaaacgtaatataatggatgtgagtgac
ttactggaggacaaggtggtcgctttccaacatagatattacgggatccttgttcttctt
attggggtaatgtttccaacacttgttcctgttctgttctggggcgaaagtttcacgttt
gcttttttccttaacatgagccgatactgtgtattgttaaatagtgtttctatgataaat
agcgtcgcccatatatgggggtatagaccttatgatgacacaatcggaccagccgagaat
tcaatatgtgcgtttgcagcaatgggtgaaggctaccacaactaccaccatgttttcccc
cacgattaccgaaccagtgagcttggtatgaaactaaacatcaccgcttcctttattgac
atgatggaaaagttggggttggcttacgaccttcggaccatgagtaacgaagttataact
gagaggaaacgaaagaatctactcaggaaagagcaatga

DBGET integrated database retrieval system