KEGG   Ciona intestinalis (sea squirt): 100185726Help
Entry
100185726         CDS       T01056                                 

Definition
protein disulfide-isomerase TMX3-like
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 455 aa AA seqDB search
MWNKILFLVILVCWGAEGRVLELDERFLKVESQGLWLVMFYAPWCGHCKNLEPTWIEVGA
ELAKGNSEVSVARLDATKYSAITSKYQVRGFPTIKFFKHGTTFDYDGPRSKENIVSFVSR
AKGPSVVDIRNHAEFLQIKQRSTVFFAYVGAADTNLRKMFDETANSLFTSIDFYSIRDVS
ILKGMKIETTPTVVVFKDKKFYEMPANPMSSDFVQMWIRSEQFPSYNALTGMSYHSLRGA
GLRFAVAAVNKNDKFNTTMKDIALKRNYPYTFCWVEGNGIVNSMTYGTISVPNLVVFDTN
SYEYYTLCEEGDCESKLNEKEVTKFFKDIKDGVIEPKGGRGFWQQTKRFVTDAIGSVVGF
FRESPIIASLVILLPTVVISGLCVCLCSITDGQEDGEQYTDDEDEEEDDLPPYNPDDLEQ
NTELEEELLHEDLAIGDSSEGVRQRVNIKPQEETG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtggaataagatcctattccttgtcatattagtttgttggggcgctgaaggacgtgta
ctggaattggatgaaaggtttttaaaagttgaatctcaaggattatggctggtgatgttc
tatgctccgtggtgtggccattgcaaaaatttagagccaacatggatagaggttggagca
gaacttgcaaaggggaattctgaagtttctgtggcacgccttgatgctactaagtattcc
gccatcacatcaaaataccaagtccgtggttttccaacaattaagttcttcaaacatggt
acaacatttgattatgatggcccaagatcaaaagaaaatattgtttcttttgtcagccgt
gcaaaggggccttcagttgtggatattcgtaaccatgctgaatttcttcaaattaaacag
cgctcaacagtgttttttgcttatgttggagctgctgatacaaacttaagaaaaatgttt
gatgaaaccgcaaattccttgttcaccagcattgatttttactccattcgggacgtctcg
atacttaagggcatgaagattgaaactacaccaactgttgttgtgtttaaagacaaaaaa
ttttacgaaatgccagcaaacccaatgagttccgattttgtgcaaatgtggattcgttct
gaacagtttccaagctacaatgctttaactggtatgagttaccatagtttgagaggtgct
ggtctgcgctttgctgttgcagctgtgaacaaaaatgacaaatttaacacgacaatgaag
gacattgctttaaaacgaaactacccatatacattttgctgggtggagggaaatgggata
gtcaacagcatgacatatggtacaatttctgtaccaaatctggtggtatttgacacaaat
tcctatgaatactacactctatgtgaggaaggcgattgcgaaagtaaattaaatgaaaaa
gaggttacaaaattctttaaagatatcaaagatggtgtaattgaaccaaaaggaggtcgt
gggttttggcaacaaactaaaagattcgtaactgatgcaattggttcagttgtgggtttt
ttccgtgagagtccaatcatagccagtttggtcattctgcttccaacagttgtaatctcg
ggattgtgtgtttgcctctgttcaataacagatggtcaagaagatggagagcaatacaca
gatgatgaggatgaggaagaagatgatctacctccatacaaccctgatgacttggaacag
aatactgaattggaagaagagttattgcatgaagatcttgctattggagattctagtgaa
ggtgtaagacagcgagtcaacattaagccacaagaagaaacaggataa

DBGET integrated database retrieval system