KEGG   Ciona intestinalis (sea squirt): 100185729Help
Entry
100185729         CDS       T01056                                 

Gene name
cdc27
Definition
cell division cycle 27
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:cin04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 877 aa AA seqDB search
MTVLQDPIKSAIWHCLNHYAYKDAMFLAERLYAEVASDEAMFLLATSYYRSGKPKVVQIL
LEKHGMRQPECKLLYAQACWDLENYAQAEHVLAGGSIKFKSIVNIVSDVQMEYGDSASFA
LSLLGCIYQHTERGDWAEYCLTSSLKANPFLWSSFEQLCEAGNTPNIDELFPSNVCGTSE
FKTPYISSFNMSLQQTPQIVQARRKKGNTVKILAPSQVGSNTDRADPNTSLSPTLIPMQT
PDQSHPTLGCPMVQTTPSSEDTRGLDRTSSCKERSVDQDNSDFLRSTPSENQWDSSVDSY
TGLQSRKKHSRTQQRISRSLMGGPAALSPLTPSFGVMPLVETPSPAWERSVTMITPSELT
APPMDINPPVKKMITRQSRKNELTNATGKLLFSSENSRRSQEVQISTSEAPSALSSTRRS
TRNYSNTGSSVKENTKKTTRGKQAQPKDVLKRNTRLRHTKPLISDGTVRDLSEEINKVDS
GCEKSHSTTTNATQVLSAQKAAIDGLMSLLCDMGKALVALCHYDCRKAISCIESLPSNQR
DTCWSLSLLARAYFEMTEYKKAAKTFNELRSMFPHQVSGLALYSTTLWHLQDNIALCTLA
HDLKNVDPLSPETWCCIGNCFSLRRDNENAIKFFARAVQLDTHYAYAHTLLGHEYAYSDD
NDRAMASYRRAIHCDKRHYNAWYGIGSIYYKQENFSLAEIHFKKALSINRKSSVLLCHLG
IVQHAQKRSSVALQTLANALTLEPRNPLCKFHRASILFATEQHKEALKELLELKLIVPKE
SLVYFLIGKVYKVLGENHLAMMNFSWALDLDPKGINNHIKEAIDKQQGADDGFDSSHLGS
QTRDADESGSTADIMNSIIDEVESTEHEMLADSDESL
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgactgttctgcaagatcctataaagagcgctatttggcattgtctgaaccattatgcc
tacaaagatgccatgtttttagcagagcgcctgtatgctgaagttgcatcagatgaagca
atgtttttgttagcaacttcatattaccgatctggtaaaccaaaagtcgtccagatctta
ttggagaaacatggaatgcggcaacctgaatgtaaacttctgtatgctcaagcttgttgg
gacctcgagaattatgctcaagccgaacatgtgcttgctggtgggtctataaaatttaaa
tctattgtaaacattgtttctgacgttcaaatggaatatggtgattctgcttcctttgct
ctgtcacttctcggttgtatataccaacacacagaaagaggtgactgggctgagtactgc
ctcactagcagtctcaaggcaaacccttttctgtggtcttcgtttgagcaactgtgtgaa
gcaggaaacacgccaaatattgacgagcttttcccctccaatgtatgtggcacatctgag
ttcaaaactccctatatttcatcgtttaatatgtccctgcaacaaaccccacaaatagtt
caagccagaaggaaaaaaggaaacacagttaaaatattagctccaagtcaggtaggatcc
aacactgatcgagcagatccaaatacttcactctcaccaactctaattccaatgcaaaca
ccagatcaatctcatccaacacttggttgtcctatggtgcagacaacaccatcttctgaa
gacacacgtggtctagaccgtacatcttcatgtaaagaaagatctgttgatcaagacaat
tcggattttctacgatcaactccatctgaaaatcaatgggacagctcagttgattcctac
actggccttcaatctcgtaaaaagcacagtcgtacacagcagcgaatatcaagaagctta
atgggaggtcctgcagctctaagtcctttaacacccagttttggtgtgatgcctcttgtt
gagactccaagtccagcttgggagcgatcagtgaccatgatcactccatcagagctcact
gcacctccaatggatatcaatcctccagttaaaaagatgataacaagacaatcaaggaaa
aatgaacttaccaacgcaactggaaaacttcttttttcatctgaaaacagccgtcgtagt
caggaggtacaaatctcaacaagcgaggccccgtccgcactttcctccacacgtagaagt
acacgaaactattcaaacactggcagttctgtcaaggagaatacaaaaaagacgacgaga
ggaaagcaagctcaacctaaagatgttttaaagagaaacacccgtctaagacacactaaa
cccttaatatctgatggaactgtacgagatttatcggaagaaatcaacaaagtggattct
ggttgtgaaaagtcgcattcaaccactaccaatgctacacaagtcttgtccgcacagaaa
gctgcaattgatggattaatgtcactcttatgtgacatgggcaaggcactggtggcctta
tgtcactatgattgtagaaaagcgatttcctgcattgaatctttaccttcaaatcagcgt
gatacatgttggtcactctcactacttgcacgtgcctattttgaaatgaccgaatataaa
aaggcagcaaagacattcaatgaactacgttccatgtttcctcaccaagtatctggattg
gctctctatagcaccaccttatggcatttacaagacaacatcgcactgtgcactcttgcc
cacgaccttaagaatgttgaccccttgtctccagagacatggtgctgcataggaaattgc
ttctccctccgccgtgacaatgaaaatgccatcaaatttttcgcaagagccgtgcagctt
gacacacattatgcatatgctcatacactactaggtcacgaatatgcatatagtgatgac
aatgatcgtgccatggcaagctataggagggctatacattgtgataaaaggcattataat
gcatggtatggaattggatctatttattacaaacaagaaaacttttctcttgctgaaatt
catttcaagaaagctttgtccatcaatcgaaaaagttctgtgctgttatgtcatttaggg
attgttcagcatgcacagaagcgttcctctgttgctctacaaaccttagcaaacgcactc
accttagaaccacggaatccactctgcaagttccatcgtgccagtattttatttgccact
gagcaacacaaagaagcattaaaagaattacttgaactgaaactaatcgttccaaaagaa
agtttggtttattttcttataggaaaggtttataaagtccttggagagaatcaccttgca
atgatgaatttctcatgggctcttgaccttgatccgaaaggaatcaataaccacatcaag
gaagccattgataaacaacaaggagcagatgacggctttgacagcagtcatcttggttca
caaacacgagatgcagatgaatctggaagcactgctgacattatgaattcaataatagat
gaagtagaatctactgaacacgaaatgcttgctgatagtgatgagagtttatga

DBGET integrated database retrieval system