KEGG   Ciona intestinalis (sea squirt): 100185782Help
Entry
100185782         CDS       T01056                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100185782
Peptidases [BR:cin01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100185782
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100185782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
12
AA seq 340 aa AA seqDB search
MMSLWTLFGSFLFKFSTILKLAAAFYVAVPLAIKYVPQIVAKATFLNFICPPLRLLNLTK
PEQWGLSNVTNSSIQSSDGINLGMWHIKPKYTSHLQNASKVIIYCHGNAGHRGFGHRRYI
LKLFQSLGYHVIAFDYRGFGDSEGKPSQNGVVQDTLTVYKWVVKHTQSECRIYVWGHSLG
TSIATHAIAEVQSTMVKQPEGLILEAPFTSISEAIFRYPLSRYLLHLYPTEFIHNLICAA
FKRNSIQFSTVQVLPLIKCKVLMLHAMDDTKVDYSLGEKLFNEMKACGICKCPFIKFYSF
EKLHGFGHNYIHKYPKLPALLTDFEDSKPGSEQEFLSATF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgttatggacgcttttcggctcatttcttttcaagtttagcaccattttaaag
cttgcagcagcgttttatgtcgctgtaccattagccattaagtatgtgccacaaatcgta
gcaaaggcgacgttcttgaactttatttgtcccccattgcgactgttaaacttaacaaaa
ccagagcaatggggcctttcaaatgttactaactcttccatacaaagttctgatggtata
aacctcggcatgtggcatatcaagcctaagtacaccagccatttgcaaaacgcttcaaaa
gttataatttattgccatggaaacgcaggtcaccgaggttttgggcaccgtcgatatatt
cttaagctttttcagagccttgggtatcatgtgatcgcatttgactacagagggtttggt
gattctgaaggtaaaccatcacagaatggagtcgtacaggatacactgactgtttataag
tgggttgtaaaacacacacagtctgagtgcaggatatatgtctggggtcactcactaggc
acttcaattgctacacatgctattgcagaagtacaatcaaccatggtgaaacaaccagaa
ggtctaattctagaagcaccatttacttcaataagcgaagctattttccggtacccactg
tcgagataccttttgcatttatacccaactgagttcatacataatctaatttgtgctgct
tttaaacggaacagtattcagttttccactgtacaagtcctgcctttaataaaatgtaaa
gttctaatgcttcatgccatggatgacactaaagtagattacagcttgggtgaaaaactt
ttcaatgaaatgaaggcatgtggtatttgcaaatgtccgtttataaagttttactcgttc
gaaaaactccatggttttggacacaactacattcacaagtatccaaagctccctgcactg
ttaactgactttgaagacagcaaacctggctctgagcaagagtttttatcagctactttt
taa

DBGET integrated database retrieval system