KEGG   Ciona intestinalis (sea squirt): 100185905Help
Entry
100185905         CDS       T01056                                 

Definition
ribose-5-phosphate isomerase-like
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:cin01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cin01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cin00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 263 aa AA seqDB search
MKFGSICRSIYSVVRMSTTNSSLTNGVENAKRVAAFTAANNFVQNGYVIGVGSGSTIEYA
VERIAERVEAENLKVTCVPTSFQARELILKYKLSLSDLDRHSKLDVAIDGADEVDEQFTL
IKGGGGCLTQEKIVAAAAKKFVVIADFRKKSTNLGENWKKGIPIEVVPMAILQIQNKIKE
KYGGICTIRLAKSKAGPVITDNGMMIVDWQFDKSHNWSEVHQFIKLIPGVVETGIFFNMA
DIVIYGTENGQSDIKANTTVLTK
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggttccatttgtaggtcaatttattcagtagttagaatgtctaccacgaat
tcttcgctcacgaatggagttgaaaatgctaaacgtgtcgccgcttttaccgccgccaac
aatttcgtacagaatggctatgtaattggtgttggcagtggttcaactatagaatatgct
gtagaacgcattgcggaaagagtagaggctgagaatcttaaagtgacatgcgttccaact
tcattccaagccagagaacttatattaaagtacaagctttcactaagtgatcttgaccga
cattccaagcttgatgttgctatagatggagctgacgaagtggatgagcaatttaccctt
atcaagggtgggggtggatgtttgacacaagaaaaaattgttgcagcggctgccaagaag
ttcgtagtcattgcagatttcagaaagaagtcaaccaaccttggtgaaaactggaaaaaa
ggaattcctattgaggttgttccaatggcaattcttcagattcaaaacaaaataaaagag
aaatatgggggaatctgcactatacgacttgctaaaagcaaagcaggtccagtgatcaca
gacaacggaatgatgattgttgattggcagtttgataaaagtcataactggtctgaggtc
caccagtttattaaacttattccaggtgtcgtagagactggtatatttttcaacatggcc
gatattgttatatatggtactgaaaatggacagtctgatattaaagcaaatacaactgtg
ctgacaaaatag

DBGET integrated database retrieval system