KEGG   Ciona intestinalis (sea squirt): 100185969Help
Entry
100185969         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 30-like
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 487 aa AA seqDB search
MFTNGRWILSLTVFSGIFLAWLSWYNKRTSRNYERKRKNKKLKYVVPGLLNVGNTCFMNV
VLQSLASTSKLYIAFQKSPKSVKPVSAQDSLCEIIKVLNTGSDVNYYDPSNLLLVLKQLG
WHISMDEHDAHEFFHVLLSTLNEEMEVKKTECTIMNAVNGENRLFNVKQRCIQDVNVLQN
NSTSNINLYGIFRGLLSIRLKCVSCGQKTPVKFDGFDSLSLPIPETSVWIGRTTMSECLK
QFFAAEVVKSVDCDACTQLANSESTKKKIQRKKLNTDSLNINKISEKLWRNYYSRDERKT
GIAQTKIKSNFKREVMLAKLPQCLTFHLQRLVWKHGFPVKNHTHVQFEEFLNLSEFLFST
NLQRKTTSCAVRKPNPLILKLLSNNNSRSNNFKTLNHCGLLGGFSDNVKHCKPQNAWYKL
CAVVVHIGSWTESGHYVAYRRVQTETFNVSKSKWVFTSDTVVRPASLSEVLSSPAYMLFY
ERVPFVN
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgttcacaaatggaaggtggattttgtcactcactgttttcagtggaatttttcttgct
tggttatcatggtacaacaagcgtaccagtagaaattatgaaagaaaacgcaaaaacaag
aaattaaagtacgtagtgccaggtttattaaacgttgggaacacatgttttatgaacgtt
gtcttgcaaagtttagcatctactagcaagctgtacattgcgtttcaaaaatctccaaaa
tcggtaaaaccggtcagtgcacaagattcattatgtgaaataataaaggtgttgaataca
ggctccgatgtcaattactacgacccatctaatttgttgcttgtattaaaacaactggga
tggcatatttcaatggatgagcacgacgcacatgaattttttcatgttttgttgagcacg
ctgaatgaagaaatggaagttaaaaaaactgaatgcacgataatgaatgctgtaaatgga
gaaaatagattgtttaatgttaaacagagatgcatacaagatgttaacgtgcttcaaaat
aattctacttctaatattaatttgtatggaatttttcgtggattgctttcaataagactt
aaatgtgtttcatgtggccaaaaaactccagttaagtttgatgggtttgacagtttaagc
ttgccaatacctgaaacctcagtttggataggaagaactactatgtcagaatgtttgaag
caattttttgcagctgaagttgtaaaatctgttgattgtgatgcttgtacccagctcgca
aattctgaaagtacaaaaaagaaaatccaaagaaaaaaattaaacaccgacagtttaaac
ataaacaaaatttctgaaaaactgtggagaaattattattcacgtgatgaaagaaagact
ggtattgcacaaactaagataaagtctaattttaaacgagaagtcatgcttgcaaagttg
ccacagtgtttaacttttcatcttcaacgtttagtttggaaacatgggtttcctgtgaaa
aatcacacccacgttcaattcgaggagtttttgaacctcagcgaatttttattttcaaca
aacttgcaacgcaagactacaagttgtgctgtgaggaaacctaatccactaatattaaaa
ttattatcaaataataactctcgctctaataattttaagacacttaaccactgtggttta
cttggtggtttttctgataatgtaaaacactgtaaacctcaaaacgcttggtataaatta
tgcgctgtagttgtgcatattggtagctggacggaaagtggacattatgttgcttaccgc
agagtgcagactgaaacttttaatgttagtaaaagtaaatgggtctttacatctgatact
gtagtgcgacctgcaagcctcagtgaagtcctatcttcccctgcatatatgttattctat
gaaagagtgccttttgttaattaa

DBGET integrated database retrieval system