KEGG   Ciona intestinalis (sea squirt): 100186099Help
Entry
100186099         CDS       T01056                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100186099
   00052 Galactose metabolism
    100186099
   00500 Starch and sucrose metabolism
    100186099
   00520 Amino sugar and nucleotide sugar metabolism
    100186099
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100186099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 487 aa AA seqDB search
MPEQSVDIHSAEKSEDFKTKTAQDGIINRVFKALELRHSTAEGIRRQSSTNYVDWELLFS
DPNLSPSRGSTMQRTQSIMEFQQLMKNDAKSALRYELDKLGNTAEKEYREIIKKDLANFE
TLFKRFLLKSGPSIVWNDIKSPPEGYIKSYSEISKPTLSGTEKHLLSKLVVVKLNGGLGT
SMGCTGPKSLISVRSGLTFLDLTVQQIESLNKKYDAQVPLVLMNSFNTDDDTNMILRKYA
SCHVKIHTFNQNRYPRINKESLLPIAQSCNDPLEAWYPPGHGDVYECFVKSGLLDKFVKE
GREFVFVSNIDNLGATIDLNILNMLVNPPEGSKPCDFVMEVTDKTRADVKGGTLIEYENK
LRLLEIAQVPKEHVDEFKSVSKFKIFNTNNLWMSMQSISELTTAGKMEMEVIVNNKRLAN
GTNVIQLETASGAGIKNFHNAIGINVPRSRFLPVKKTSDLLLVMSNLYELKNGSMVMSSK
RQFPTTP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcaaagcgtggatatacatagtgccgaaaagtcggaggattttaagaccaaa
acggcccaagacggaatcataaatagggtttttaaagctttagagttgagacattcaacg
gcagaaggaattcgtcgtcaatcatcaacaaactacgtggattgggaacttctcttctcc
gatcctaacctctccccatcacgaggatcaacaatgcagaggactcagagcattatggag
tttcagcagctcatgaagaacgatgcaaagtcagcgcttcgttatgaacttgataaactt
gggaacactgcagagaaagaatacagagagataatcaagaaagatttggcaaattttgaa
actttattcaagcgattcttgcttaaatccggaccttctattgtttggaatgatatcaag
tctccaccagagggatatatcaaatcttacagtgaaatctcgaaacctactttatcggga
actgaaaaacatcttctcagcaagttggttgttgtcaagttaaatggtggcctcggcacg
agcatggggtgtactggccctaaaagtttgatctctgttcgtagcggactcacttttctt
gatctgacagtccagcagatagagtcattaaacaagaagtacgacgcccaagttcctctg
gttttaatgaattcattcaacaccgatgatgacacgaatatgattctacgtaaatatgcg
tcgtgtcacgtgaaaatccacactttcaaccaaaacaggtaccctcgcattaacaaagaa
tctcttcttccgattgcgcaatcttgtaacgatccactagaggcgtggtatccacccggt
catggagatgtttacgagtgttttgtcaagtccggtctgctcgataaatttgttaaagaa
ggccgcgagtttgtctttgtttcaaacatcgacaacttaggggcaaccattgacctcaac
atcttaaacatgctggtaaatccacctgagggcagcaaaccatgtgattttgtgatggag
gtgacagataaaacaagagctgatgttaagggtggtactcttattgaatacgagaacaaa
cttcgtttgctcgagattgcgcaagttcccaaggaacacgtggacgagttcaaaagtgtt
tcaaagttcaagatcttcaacaccaacaacttatggatgagtatgcagtctatatcggaa
ctaacaactgctgggaaaatggagatggaagttattgtgaacaacaagagacttgccaat
ggaaccaatgttattcaacttgaaactgcaagtggagctggaattaaaaactttcacaat
gcaatcggtatcaacgttcctcgaagccgttttctacccgtgaaaaaaacttctgatctt
ctgctggtaatgagcaacctctatgagttgaagaatggatcaatggtgatgagtagcaag
cgtcagttcccaaccacacct

DBGET integrated database retrieval system