KEGG   Ciona intestinalis (sea squirt): 100186164Help
Entry
100186164         CDS       T01056                                 

Definition
eukaryotic elongation factor 2 kinase
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     100186164
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   100186164
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 736 aa AA seqDB search
MSAEVRNAMYSTTSESDSDDSDFDMGDGDFSLFGDLSSGDSSTDSKSPDEQANSDSNSSE
EANAETEVIEDNLRHIVFRSMTNQILKSQEKDLTKDWNEVRKITNQNQRQKRMWKLSASH
ITATKRDGWKNINSLPTERAKRFRYSPRKGTWTEDEIQLKVETEPFSNGAMRECFKAKKL
SNFGNATDWATATYCVVKRYMDVPDKKTLFDDVRLQMDAKLWGEEYNKHHPPKKVDIMQM
SVIEMLDRPGQPYFHLENYIEGDYVKYNSNSGFVHDEDARTTPQAFSHFTFECSQHRLIV
VDIQGVGDLWTDPQIHTYKGTEYGDGNLGTRGMALFFFSHTCNKICQSLNLSPFDLTFHE
KSNCRRASVFARRGTLPTGYEEPLSPLIKNSNDLFKILEESSSYLPPRSSEGNDELYMLQ
EEDESEGTISNSSSVSKRLISRKLSSEDDFDSTSSGYGSVRRARTISELSDHLEYKEMLT
NGSTSPHPDDMIVGSPDPHLCLASNRVNLMRRASCAVAEVAKMLQLSPKVQIGKSILGKI
HYAMAVYYDIGRFPFDEDSALFHLETSAECGSLEGILTLAQIYLGMPHDILSQVTLEQNE
ENTEKGFDLVQSAAEAGDRNSMLITAKAFYTGIGLPPSKSRNYLRALELFTKLLNGHDTD
AEGGYDSVTSRVVQEHEVLAYQAEIYLKGGYGIIQDPNRSGELYNEAAEAATAAMKGRLA
NKYFALAEEAWAECEE
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaagtgcgaaatgccatgtattccaccacatctgagtcggattctgatgat
tctgactttgacatgggggatggagatttttcactatttggtgatctttcctcgggggat
agttcaactgactctaaatctccagatgaacaagccaactctgatagcaattctagcgaa
gaagcgaacgcagagactgaagtaattgaagataatctgcgtcacattgtgttcaggtca
atgacgaatcagatactaaagtcacaggaaaaggatcttacaaaagattggaacgaggtt
cgtaagatcaccaaccaaaaccaacgacaaaaaagaatgtggaagctttctgcttctcac
ataacagccacgaagagagatggctggaaaaacatcaattcacttccaacagaacgtgca
aagagatttcgatacagtccaaggaagggaacttggacagaagatgaaattcaactaaaa
gttgaaacagaaccattcagcaacggtgctatgagagaatgcttcaaagctaagaagctg
tccaactttggaaatgctactgattgggcaacagccacatactgtgtggtgaaaaggtac
atggatgttccggataagaaaacattatttgatgatgtacggttgcaaatggacgccaaa
ctatggggtgaagaatacaacaagcaccatcctcctaagaaggttgacattatgcaaatg
agcgtgatcgagatgttggaccgaccaggtcaaccatatttccaccttgagaattatatt
gaaggagattacgtgaagtataattccaactcaggcttcgttcatgatgaggatgcacgg
acaacacctcaggcgttcagtcacttcactttcgagtgctctcaacacagacttattgtg
gtggatatccaaggggtgggtgatctctggaccgaccctcaaatacatacttacaaagga
acagaatacggcgacggcaacttaggaacacgaggaatggctctctttttcttctcacat
acttgcaacaagatctgtcaaagtcttaatttgtccccatttgacttaaccttccacgag
aagtccaactgcagaagggcatctgtgtttgctcgacgtggtacactacccactggttat
gaagaaccgctttcacctttgattaaaaattctaacgatctcttcaagatattggaggaa
tcttcaagttacttaccacctaggtccagtgaaggtaatgatgagttatacatgctacaa
gaagaagatgaaagtgaaggaaccatctccaacagcagcagtgtctctaagcgcctcatc
tctcgcaaactaagctcggaagatgattttgattccacgtccagtggatacggatcagtg
agaagagcgagaaccatcagcgagttatccgatcacttggaatacaaggagatgttgacg
aacggttcaacctccccacatccagatgacatgatcgtgggatcgcccgatcctcatctg
tgcttggcgagcaatcgagtaaatttaatgcgacgcgcgtcatgcgcagttgctgaagtc
gccaaaatgttacaactctcgccaaaagtgcaaattggaaaatctattctaggaaagatt
cattatgcaatggctgtgtattatgacattggaagattcccctttgatgaagattctgct
ctctttcacctcgaaacatcagctgaatgtggatcattggaaggcatacttacccttgct
caaatatatcttgggatgccgcatgatattctgtcgcaagtcacacttgagcaaaatgag
gagaacacagagaaaggttttgatttggtgcaatcagctgcagaagctggtgatcggaat
tcaatgcttataactgctaaagctttttacacaggaattggtctgccaccttctaaatct
cgcaactacctaagagcgctggaattattcaccaagttgttgaatggacacgatacggat
gcagaagggggttacgattctgtcacgtcgagagttgtgcaagagcatgaggttcttgcc
tatcaggccgagatttatctcaagggtggatatggaattattcaggaccctaaccgatct
ggcgaactttacaatgaagctgctgaagctgccactgctgctatgaaaggaaggttggcg
aacaaatactttgctcttgcagaggaagcatgggcagaatgtgaggagtga

DBGET integrated database retrieval system