KEGG   Ciona intestinalis (sea squirt): 100186259Help
Entry
100186259         CDS       T01056                                 

Gene name
plcb4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100186259 (plcb4)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100186259 (plcb4)
   04070 Phosphatidylinositol signaling system
    100186259 (plcb4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100186259 (plcb4)
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100186259 (plcb4)
Membrane trafficking [BR:cin04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100186259 (plcb4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100186259 (plcb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
Un
AA seq 991 aa AA seqDB search
MEHSTMEMPGFLWQGTQCTFVKSKDTNISYDGINPSCLLRLDEEGMFVMWQFNNQKEVHV
LECSNLREATTGIQAKDIKGTNEMMTQRILTIFHGHEISNLVVVQFVLKSNEEAKVWADN
ITKVSYELKYRHLSPLSIMRKQWKRIYLPINNKGLIPVRRLVKSFTSDRNEKVVLQKLKT
CGLIYGKKDEISQSEFSFEFYQKLYNKMCSRGDVENIFHEISHNDIIDIDALVEWMNDNQ
RDPRHNEILVPAFDRKQAANIIQKFEPSQRNIKNNCLSLEGFTLYLASDENPLIYFDKIS
LHADMEQPLSHYFINSSHNTYLTGFQIRGKSSVDIYRHILLSGCRCIELDCWDGKGELHG
EPIITHGKAMCTDVLFKNVLVAIRDAAFVTSQYPVILSFETHCSKPLQHKMAMYCREIFG
EMLLDRNLESHPLLPGQPLPSPHQLQRKILIKNKRLQPDVEKAQLEDLKSDSVTWGDDDV
TDETLEEAHPELQSTKSCDDTKLNISSQSCMSDISVESNIEKGLLKPLVATKSNDSTKKS
SIRKPVDGDVEADLMLVYYAYQKTSATNIHPSLSVLVNYCQSVKFPGFKKVQAESEKCCF
HMSSFSENGGMNYIKSNAVNLTNYNKSQLSRIYPRGNRVDSSNYMPQIFWNVGCQLVSLN
YQTSDLGMQLNLAKFEYNAACGYLLKPEALRQENKSFDCFAESTIDGVIAAQCGVKIISG
QFVSTTSSFVEVDMYGLPNDTIRKEFRTSIVANNGLNTIYKSNEFLFRKVIYPDLAMLRF
TLYDDGRQLIGQRVVPLNSLQTGYRYVPLRSPGGVPLDSTTLFVKINLKSYVPDNLLGEL
RDEDSVAMNGSCCLFQFLRGYHGNEEHNEQRFDKIEGECGTVKRRALVSALDAIHKEAIE
SMKQNHKTEMTELTSDQTKQWMAHSKQFNKNKQIPSAERERRVRELKSQSVKKFTDQRLK
LSNKHGKQLEKLELDQKEVSTRINQQIDKLV
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atggaacattcaaccatggaaatgcctgggtttctgtggcaaggaacacaatgtacgttt
gttaaaagtaaagatacaaacatctcgtacgatggaataaacccgagttgtttgttacgg
ttggacgaagaaggaatgttcgttatgtggcaatttaacaatcaaaaggaggtgcatgtg
ttagagtgttccaatttacgtgaagctacaactggtatacaagctaaggacataaaaggt
accaacgagatgatgactcagcgtatattgacaatatttcacggacatgagatcagtaat
ttggtcgtcgtgcagtttgttctcaagtccaatgaagaggccaaggtatgggcagacaac
atcacgaaagtgtcgtacgaacttaaataccgacatttatctccgctgtctattatgagg
aaacagtggaagcgtatttatcttccaatcaacaacaaaggtttgattcccgtcagaagg
ctggtgaaaagttttacttccgatcgaaacgagaaagtggttttacaaaagttgaaaacc
tgcggattaatttatggaaaaaaagacgaaatcagccaatcagaattctcgtttgagttt
tatcaaaaactttacaataagatgtgttcgaggggggacgtggaaaatatattccatgag
atatcccacaatgacatcatagacatagacgcgttggttgaatggatgaacgacaaccag
cgcgacccgcgtcacaacgagatcctcgtccccgcgttcgatcgtaaacaagcggcaaac
atcattcagaagtttgaaccttcacaaagaaacatcaagaataattgtttatcattggaa
ggctttacattatacctcgcaagcgatgaaaatcccttgatttatttcgataaaatatca
cttcacgccgacatggagcaaccattgtcacattatttcatcaattcatcgcacaatact
tatctaacaggtttccagattcgagggaaatcttctgttgatatttatcggcatatacta
ttgtccggttgcagatgtatagagttagattgttgggatggaaaaggtgagttgcacggg
gagcccataataacgcacgggaaagccatgtgcaccgatgttttgttcaagaatgtattg
gtcgccattcgtgatgctgcatttgtgacatcacagtaccctgttatattatcgtttgaa
acgcattgcagcaaacccctccaacacaagatggcgatgtactgcagggaaatattcggc
gagatgttgttggaccggaacctcgagtcgcatccgttactcccgggacaaccccttcca
tcgccccatcaacttcaacggaagattttgatcaaaaataaaagattgcaacctgatgta
gagaaagcgcaacttgaagatttaaagtcggattcggtgacgtggggtgatgatgatgta
acagacgagacactagaagaggctcatccagagttgcaatcaacgaaatcttgtgacgat
acgaaactaaatatttcatcgcaatcttgcatgtccgacatatcggttgaatctaatatc
gagaagggactccttaaacctctagtggcaacaaaaagcaacgattctacaaagaaatct
tcgattcgaaaaccagtggatggcgatgtagaggcggacctcatgctcgtgtattacgct
taccagaaaacatcggccacaaatatccatccttcactctccgtcctcgttaattattgt
caatcagttaaatttcctggtttcaagaaagtacaagctgaatcagagaaatgttgtttt
cacatgagttcattcagtgagaatggcgggatgaactacatcaaatcaaacgctgtgaat
ttaacaaattacaacaaatcacaattgagtcgtatttatcctcgaggtaatcgtgttgac
tcgagtaattatatgccacaaatattttggaacgtgggttgtcagctcgtttcactcaac
tatcaaacgtcagaccttggcatgcagctcaacttagccaagttcgaatacaatgcagct
tgtggatatttattaaaaccggaagctcttcgtcaagaaaataaatcgttcgattgtttc
gctgaatcaacaattgatggcgttattgctgctcaatgtggtgttaagataatatctggt
cagtttgtttccaccacatcaagtttcgtagaagtcgacatgtatggcttacctaacgat
acaattcgtaaagaattccgaacatccattgttgccaacaatggtcttaatacaatatat
aagagcaacgagtttctgtttagaaaggttatataccccgacctagcaatgctacgtttc
acattatacgacgatggtcgacaacttatcggtcaacgagttgttccattgaattcttta
caaacaggatatcggtacgtaccattacgatcaccgggtggcgtaccacttgattcaaca
acattgttcgtcaagatcaatctcaaaagttacgtgcccgataatttacttggtgagttg
cgtgatgaagattcggttgcgatgaatggaagttgctgtttgtttcagtttttacgaggt
taccatggcaacgaggaacacaatgagcaacgatttgataaaatagaaggggagtgtggg
acggtgaaaagaagagccctcgtgtcggcgctagatgcaatccacaaggaggcaatagag
agcatgaagcaaaatcataaaactgagatgacagaattaacatcagatcaaacaaagcaa
tggatggctcattcaaaacaattcaataaaaataaacaaattccttcagccgagcgggaa
cgaagggtacgagagttgaaaagtcagtcggttaaaaagtttacggatcaacgattaaag
ttgagcaacaaacacgggaaacagttggaaaagttggaactagatcagaaagaagtttca
acaagaatcaaccaacaaattgataaactagtttag

DBGET integrated database retrieval system