KEGG   Ciona intestinalis (sea squirt): 100186259Help
Entry
100186259         CDS       T01056                                 

Gene name
plcb4
Definition
phospholipase C, beta 4
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cin00562]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cin04310]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cin04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 828 aa AA seqDB search
MEHSTMEMPGFLWQGTQCTFVKSKDTNISYDGINPSCLLRLDEEGMFVMWQFNNQKEVHV
LECSNLREATTGIQAKDIKGTNEMMTQRILTIFHGHEISNLVVVQFVLKSNEEAKVWADN
ITKVSYELKYRHLSPLSIMRKQWKRIYLPINNKGLIPVRRLVKSFTSDRNEKVVLQKLKT
CGLIYGKKDEISQSEFSFEFYQKLYNKMCSRGDVENIFHEISHNDIIDIDALVEWMNDNQ
RDPRHNEILVPAFDRKQAANIIQKFEPSQRNIKNNCLSLEGFTLYLASDENPLIYFDKIS
LHADMEQPLSHYFINSSHNTYLTGFQIRGKSSVDIYRHILLSGCRCIELDCWDGKGELHG
EPIITHGKAMCTDVLFKNVLVAIRDAAFVTSQYPVILSFETHCSKPLQHKMAMYCREIFG
EMLLDRNLESHPLLPGQPLPSPHQLQRKILIKNKRLQPDVEKGEYDVIIVITLEEAHPEL
QSTKSCDDTKLNISSQSCMSDISVESNIEKGLLKPLVATKSNDSTKKSSIRKPVDGDVEA
DLMLVYYAYQKTSATNIHPSLSVLVNYCQSVKFPGFKKVQEKCCFHMSSFSENGGMNYIK
SNAVNLTNYNKSQLSRIYPRGNRVDSSNYMPQIFWNVGCQLVSLNYQTSDLGMQLNLAKF
EYNAACGYLLKPEALRQENKSFDCFAESTIDGVIAAQCGVKIISGQFVSTTSSFVEVDMY
GLPNDTIRKEFRTSIVANNGLNTIYKSNEFLFRKVIYPDLAMLRFTLYDDGRQLIGQRVV
PLNSLQTGYRYVPLRSPGGVPLDSTTLFVKINLKSYVPDNLLGELRAR
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atggaacattcaaccatggaaatgcctgggtttctgtggcaaggaacacaatgtacgttt
gttaaaagtaaagatacaaacatctcgtacgatggaataaacccgagttgtttgttacgg
ttggacgaagaaggaatgttcgttatgtggcaatttaacaatcaaaaggaggtgcatgtg
ttagagtgttccaatttacgtgaagctacaactggtatacaagctaaggacataaaaggt
accaacgagatgatgactcagcgtatattgacaatatttcacggacatgagatcagtaat
ttggtcgtcgtgcagtttgttctcaagtccaatgaagaggccaaggtatgggcagacaac
atcacgaaagtgtcgtacgaacttaaataccgacatttatctccgctgtctattatgagg
aaacagtggaagcgtatttatcttccaatcaacaacaaaggtttgattcccgtcagaagg
ctggtgaaaagttttacttccgatcgaaacgagaaagtggttttacaaaagttgaaaacc
tgcggattaatttatggaaaaaaagacgaaatcagccaatcagaattctcgtttgagttt
tatcaaaaactttacaataagatgtgttcgaggggggacgtggaaaatatattccatgag
atatcccacaatgacatcatagacatagacgcgttggttgaatggatgaacgacaaccag
cgcgacccgcgtcacaacgagatcctcgtccccgcgttcgatcgtaaacaagcggcaaac
atcattcagaagtttgaaccttcacaaagaaacatcaagaataattgtttatcattggaa
ggctttacattatacctcgcaagcgatgaaaatcccttgatttatttcgataaaatatca
cttcacgccgacatggagcaaccattgtcacattatttcatcaattcatcgcacaatact
tatctaacaggtttccagattcgagggaaatcttctgttgatatttatcggcatatacta
ttgtccggttgcagatgtatagagttagattgttgggatggaaaaggtgagttgcacggg
gagcccataataacgcacgggaaagccatgtgcaccgatgttttgttcaagaatgtattg
gtcgccattcgtgatgctgcatttgtgacatcacagtaccctgttatattatcgtttgaa
acgcattgcagcaaacccctccaacacaagatggcgatgtactgcagggaaatattcggc
gagatgttgttggaccggaacctcgagtcgcatccgttactcccgggacaaccccttcca
tcgccccatcaacttcaacggaagattttgatcaaaaataaaagattgcaacctgatgta
gagaaaggtgagtatgatgtcataattgttattacactagaagaggctcatccagagttg
caatcaacgaaatcttgtgacgatacgaaactaaatatttcatcgcaatcttgcatgtcc
gacatatcggttgaatctaatatcgagaagggactccttaaacctctagtggcaacaaaa
agcaacgattctacaaagaaatcttcgattcgaaaaccagtggatggcgatgtagaggcg
gacctcatgctcgtgtattacgcttaccagaaaacatcggccacaaatatccatccttca
ctctccgtcctcgttaattattgtcaatcagttaaatttcctggtttcaagaaagtacaa
gagaaatgttgttttcacatgagttcattcagtgagaatggcgggatgaactacatcaaa
tcaaacgctgtgaatttaacaaattacaacaaatcacaattgagtcgtatttatcctcga
ggtaatcgtgttgactcgagtaattatatgccacaaatattttggaacgtgggttgtcag
ctcgtttcactcaactatcaaacgtcagaccttggcatgcagctcaacttagccaagttc
gaatacaatgcagcttgtggatatttattaaaaccggaagctcttcgtcaagaaaataaa
tcgttcgattgtttcgctgaatcaacaattgatggcgttattgctgctcaatgtggtgtt
aagataatatctggtcagtttgtttccaccacatcaagtttcgtagaagtcgacatgtat
ggcttacctaacgatacaattcgtaaagaattccgaacatccattgttgccaacaatggt
cttaatacaatatataagagcaacgagtttctgtttagaaaggttatataccccgaccta
gcaatgctacgtttcacattatacgacgatggtcgacaacttatcggtcaacgagttgtt
ccattgaattctttacaaacaggatatcggtacgtaccattacgatcaccgggtggcgta
ccacttgattcaacaacattgttcgtcaagatcaatctcaaaagttacgtgcccgataat
ttacttggtgagttgcgtgcccgatga

DBGET integrated database retrieval system