KEGG   Ciona intestinalis (sea squirt): 100186514Help
Entry
100186514         CDS       T01056                                 

Definition
filamin-C
Orthology
K04437  
filamin
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100186514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 1521 aa AA seqDB search
MPTEAGDYKINVLFADKHIPGSPFNAKIEPAFDASKVDLSGPGLESGKIGKPSKICADCC
SAGDAPLTADVLNDDGTKVPTKVKDNGDGTHDITFVPNKPGKALVNVQYGGISVPKSPVS
VPIKPDVDTSGVRTTGPGVQPDGVLADVEAEFQVDAGCLAPRGGKHVTAKAVGPSGTAVP
VDLKDNRDGTYDAKYSPYEKGPHQVIVDYDDVPVPGSPFNVGVDEGCDPTKVKAYGPGLE
QGTTAKPAKFMVDTRGAGTGGLGLVVEGPSDAKITCTDSKDGTCAVEYLPTAPGEYEVNI
TYGGENIPGSPFIVPVKDTVDPTKVSCNGPGVSPGVRANVPQEFTVDCSTAGVAPLDVAV
KGPKGLKEPVDVRDNGDGTHTVKYTPTKEGPYQVQVKYADHEIPRSPYRVRVQPTHDASK
VKCNGPGIASGGVPASLPVEFTIDATDAGDGVLAVQITNPKREKYSVEMPPAPKKPTGSE
GVGPGARSPKRKSPSKSHSPTKTRPGRGSRGSEDSPGRKSRSRSGSSSSSSSSSRSRSRS
SSSSSSSSESDSPKASSPTKGSPRKSASGTGEPYERSPRKRGGVKSGAKDSPCREVHASD
PEGRPKRASVRDNGDGTYSVSYIPDTVGRYTISVKYGGDEIPYSPYRIRAVPSGDANKCL
VSGDGLGPNIYIGEEAVITVDPNGAGPGNVTCAVTTPDGEKLDADVVQNKDGTFDIFYTP
KEVGPYTINIHFGGEEVPNSPYRVTAVPGLKPAPVVEEDFQQTAVAPAYSYMNGSEPAIE
QVDGPDSLRPVQLVFEVPSRPGNLTSEVTTPSGIKESPVIKNNGDGTITVQYQPHEPGLH
EMAILLDNEHISGSPIQFYADVMAPGHVTAYGPGLVTGKVDEPANFTIVTKDAGAGGLAL
AVEGPSKADITCQDNKDGTCSVTYLPTAPGEYTVTVKFDDQHIPGSPYTANISGGADQRK
SKLSYGTTSDVALKINESDLSLLSASIEAPSGHKESCVLKKLPNGHIGISFTPKEIGEHL
VSVKKRGRHIANSPFRIMVGESEIGDASKVKVYGDGKESACAGETAVFMVDTRQAGYGGL
GLSIEGPSKVDINCEDMDDGVCRVTYTPQEPGNYVINVKFADKHVPGSPFTVVCTGDDSP
QKKGSILRQQKAASVATVGSTCDLNLKIPNNWMDLMSSGAKSTRHASSFSQSYSRVEQSS
FRSTGVSSQSQSMVRESFSPSSQSSHSLLTSSASPFVPKFTSSQGKFGTFEHSLKATGAG
LADLSAEVKSPCGDIQKAEIVETDENTYSIRFIPKEMGVHTVSVRYMGQHVPGSPFEFTV
GPLGEGGAHKVTAGGPGLEGAVVSVPADFSIWTREAGAGGLSIAVEGPSKADINFEDRKD
GSCGVSYVVTEPGDYEVNVKFNDQDIPGSPFPVTVTGVGKNTKDPQRFKSDASKVRSYGS
GLRRAVIGENTFSVDCCNAGSNMLLVGVHGPLTPCEEVHVKHVGQRKYAITYTAKEAGDY
LLIVKWGDDHIPGSPFHVKIP
NT seq 4566 nt NT seq  +upstreamnt  +downstreamnt
atgcctacagaggcaggagattacaagattaatgttttattcgctgataaacatattcca
ggatctccattcaatgctaaaatcgagccagcgtttgatgcttctaaggttgatttaagc
gggccaggtcttgaaagtggaaaaataggaaagccaagcaagatatgcgctgattgctgc
agtgctggagacgcacctcttacagcagatgtgctaaacgatgacggaactaaagttcct
accaaggttaaagataatggagatggaacacatgacatcacatttgtgcccaacaagcca
ggcaaggcattagtgaacgtacaatatggcggcatctccgtgcccaagtcaccagttagt
gttccaatcaaaccagatgtggatacaagtggagtcagaactactggccctggtgtccaa
cctgatggtgttcttgctgatgttgaagcagagtttcaagttgatgctggatgtctcgct
ccacgtgggggtaaacatgtcaccgctaaagctgttggaccatctggaactgcagttcct
gttgatttgaaagacaatagagatggaacatatgatgcaaaatactctccctatgaaaaa
ggtccccatcaagtcattgttgactatgatgacgtcccagttcctggatctccgtttaac
gttggtgtagatgaaggttgcgaccctaccaaggtaaaagcatatggtccaggcttggag
caaggtactacagccaaaccagccaagtttatggtggatacaagaggggctggaactgga
ggtcttggacttgtcgttgaaggaccttctgatgcaaaaattacatgcactgatagcaaa
gatggaacatgtgctgtcgaatacctaccaacagcacctggtgaatatgaggtaaacatc
acctatggcggggaaaatatacccggatctccattcattgtccctgtcaaggatactgtg
gaccctaccaaggtgtcatgcaatggacctggagtatctcctggagtgagagcaaacgtc
ccacaggagttcacagtagattgctcaactgctggtgtcgccccattggatgttgctgtt
aagggaccaaaaggtttgaaagaaccagttgatgtccgagataatggagacggaacacac
actgttaagtacacccccaccaaagaaggtccgtaccaagtccaagtgaaatatgctgac
cacgaaatcccaagaagtccataccgtgttcgagtacaacccacccacgatgctagcaag
gtcaaatgcaatggaccaggtattgcatcaggtggtgtgcctgcatctctgcctgttgag
tttaccattgatgccacagatgctggagatggtgttcttgctgttcaaatcacgaatcca
aagcgcgaaaaatactcagttgagatgccacctgctcccaaaaagcctactggctctgaa
ggggtgggcccaggtgctcgttctccaaaaaggaagagcccaagcaagtcgcacagccca
accaaaactcgacctggtcgaggctctcgtggaagcgaggatagtcctggaagaaagagc
cgaagcaggagcggatcaagctccagcagttcctctagtagtcgctctagatcaagatct
agctccagctcaagttccagctctgagtccgacagtccgaaagcatcaagccctaccaag
ggaagcccaagaaagtcggccagtggaacgggagaaccttatgaacgcagcccacgaaaa
cgaggtggcgttaagtcaggtgcaaaggattcaccatgcagagaagtccatgcctcagac
cccgaaggccgcccaaaaagagccagtgtgcgtgacaacggtgatggaacatattctgtt
tcttacatccctgatacggttggtcggtacaccatctcagtgaaatatggaggggatgaa
ataccttattcaccatatcgcattcgagctgtgccttctggggatgcaaataaatgcctt
gtatcaggagatggccttggtcccaacatttacattggagaagaagctgtgataactgtt
gaccctaatggtgccggacctggcaatgtcacgtgtgcagtcaccaccccagatggtgaa
aaactggacgcagacgttgttcaaaacaaagatggcacttttgatatcttctacacacct
aaagaagttggcccgtatacaattaatattcattttggcggggaagaagttcccaacagc
ccatacagagttacggctgtgcctggcttgaaacctgcaccagtggtggaagaagatttc
caacagacagcagtagcacctgcctactcttacatgaacgggagtgaaccggcaattgaa
caagttgatggtccagattcgctccgacccgtgcaacttgtgtttgaagtgccttccaga
cctggaaaccttaccagtgaagttactacaccaagtgggattaaggagtctccagtcatc
aagaacaacggtgatggaaccatcactgtacaataccagccccatgaaccaggactgcat
gagatggccatcttacttgataatgaacatatctcaggaagtcccatccaattctacgct
gatgtcatggcccctggtcatgtgacagcatatggacctggacttgtgactggcaaagtt
gatgaaccagccaactttacgattgttaccaaagacgctggtgcaggtggacttgcactt
gctgtggaaggcccatccaaagcagacattacatgccaggataataaagatggcacatgt
tctgttacttacttaccaactgcaccaggagaatacacagttactgttaagtttgatgac
caacacataccaggatctccatacacagcaaatatctctggtggagcagatcaaagaaaa
tcgaaactttcttatggaacaaccagtgatgttgctcttaaaatcaacgagagtgatctc
tctcttctctcagccagcatcgaggcaccatccggacacaaagagagctgcgtacttaag
aaattgcccaacggccatattggcatctcgtttactcccaaagagatcggagagcatctc
gtgagcgtgaagaagagaggtcgtcacatcgcgaactctcccttccggatcatggtagga
gagtccgagattggagatgcaagtaaagtaaaagtatacggagatggaaaagaaagcgct
tgtgctggggaaacagctgtgtttatggtggatacaagacaagctggttatggcggtctt
ggtttatcaattgaaggtccaagcaaggttgatattaactgtgaagatatggatgatggc
gtatgtcgtgttacatacacaccacaagaacctggaaactatgtgatcaatgtaaagttc
gcagacaagcatgtacctggttctccattcactgttgtgtgcactggcgatgacagtcca
caaaagaaaggaagcattctgcgacaacagaaagcagcttccgttgctacagttggtagc
acttgcgatcttaacctgaaaataccaaacaactggatggaccttatgtcttctggagca
aaatccacacgccacgcctcctctttcagccaatcatacagcagagtggagcagtcctct
tttaggagcacaggagtgagcagccaatcacagtccatggttcgggagagtttctccccc
tcctcccaatcctcccactctctcctcacttcctccgcttctccttttgtcccaaaattc
acgagcagccagggaaaatttggcactttcgaacattctctaaaagcgacaggtgctggc
ttggctgatttatctgctgaagtaaaaagcccatgcggagatatccagaaggcagaaata
gtagagactgatgagaacacatacagtattagattcataccaaaggaaatgggcgtacac
actgtcagtgtgcgatatatgggtcaacatgtacctggaagccccttcgagttcacagtt
ggacccctcggtgagggtggggctcataaagtcactgctggtggtcctgggttagaagga
gctgtcgtcagtgtaccagctgacttcagtatatggacacgcgaagcaggcgccggtggt
ttgtccatcgcagtagaaggaccttcaaaagcagatatcaactttgaagacagaaaagat
ggttcttgcggtgtgtcgtacgtcgttactgaaccaggcgattatgaagtgaatgtgaag
ttcaacgaccaggacatcccaggtagtcctttcccagtcactgtcacaggggttggaaag
aacactaaagacccgcaacgctttaaatcggatgctagcaaggtcaggtcgtatggaagc
ggtctcaggcgagctgtgatcggtgaaaatactttctccgtcgattgctgcaatgcaggc
agtaacatgctcctggtcggcgttcacggcccactaaccccatgcgaagaagttcacgta
aaacacgttggtcagcgaaagtacgcgattacatacacagccaaggaagccggcgactat
ctgcttatagtgaagtggggtgacgatcatattccaggcagtcctttccatgtcaaaatc
ccgtga

DBGET integrated database retrieval system