KEGG   Ciona intestinalis (sea squirt): 100186514Help
Entry
100186514         CDS       T01056                                 

Definition
(RefSeq) filamin-A
  KO
K04437  
filamin
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Cytoskeleton proteins [BR:cin04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100186514
  Intermediate filaments
   Intermediate filament-binding proteins
    100186514
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100186514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
12
AA seq 2924 aa AA seqDB search
MENHSSEVVYVGDNYDEDMPATERELAEDATWKIIQKNTFTRWCNEHLKCINKRVANLET
DLSDGLRLIGLIEILSQKKMGKHNKRPNFRQMRLENVSVALNFLEAERIKLVSIDSKAIV
DGNLKLILGLIWTLILHYSISMPMWDEEEEVEEKSKATPKQRLLGWIQNKVPQMPITNFK
GNWQDGTALGALVDNCAPGLCPDWEDWDPNNPMENTAEAMKLADEWLGVPQVITPEEITN
PHVDELSVMTYLSQFPKATLKPGAPLRPKTNGKKARAYGKGIEPKGCKVGSPAPFTVETV
SAGSGEVLVYLTNPEGHKTELQATPNNDKLKTYSVTYYPDMPGDYEVTVMFAGVGIHKSP
FKVYVDDSPADPSKVVAKGPGLLPGNIVNHPTHFDVITTDAGAGDVNVVIEDPTGCKQSV
RPKIEKQGETYKVTYTPSKNGPHHVHVLFADAPINKSPFEVPISLPLNPSAVWAEGPGVE
PNGLTVRQVANFDVHTEQAGDGKLEVKCIGPRGVTEKVNVNNNGDGTYSCDYYPTKPGQY
VVGVTYSGKAASNSPYRVNVDVPPDASKVKVQGPGIEPGNVVGEPTYFDVLTAAAMPRSY
PKPAGKGRSSYSRPMNGHVGKPLSDAGKGDVRVSVIGPDGTQSPDVPMSLEERPNSTVRA
TYTPQVQGPHKVYVEFVGEQVPRSPYHVDIAPGEVIEPMMVSEQNAPVFLEASDQMPVEE
MVQPIIEEPVQAVQVARPTEQSPAFNANACRAYGRGIQPTGLRMREKADFHVTTKDAGDA
DLKVTVKGPRGSNEPVTVKKNPKEPEVFDCEYYPLKQGNYTVDVTFGGKPIPKSPFEILV
GPEAGAQKVRAYGPGLHGGKVGHSADFVVETIGTEVGQLGFSIEGPSQAKIECEDCGDGS
CDVKYHPTEPGEYAVHVVCDDNDIKGSPFMAQIAPADTKSRPDMVKAYGPGLESGTPVNG
RPTNFTVDAKRAGAPAPVEVVAVAADGENLPVKVKDNGDGTYDCDYTPKNPIKHTIIPSY
DGVAVKDSPFRVNVNEDSYPDKVKVYGPGVEPGLKAEEPTYFTVDCARAGNGDVSIGIKC
AAGVVGPTERDVEFEIIKNDASDTFTVKYTPPGPGEHTIMVLFAEQPVPKSPITVNVASS
HNAKKVKADGPGIEKEGVECGKPTHFTIYTKGAGKAKPNVQFKPARGSYKPPASKADILD
NKDNTYTVSYTPHAEGPMDVEVTYGGDKIPNSPFPVDVAPALDVNAVKVKGLEDKMDVGK
PQEFEVLTKGAGGQGKLDVDVVGPSNLPIHVHDKKTPNGKKCHFTPVEEGPHRVNVAYDG
IPVRGSPFLVDALTPADPSKVRAYGPGLSGGVVNQSAPFTIETADAGNGGLGLTVEGPCE
AKIECIDNGDGSCSVAYMPTEAGDYKINVLFADKHIPGSPFNAKIEPAFDASKVDLSGPG
LESGKIGKPSKICADCCSAGDAPLTADVLNDDGTKVPTKVKDNGDGTHDITFVPNKPGKA
LVNVQYGGISVPKSPVSVPIKPDVDTSGVRTTGPGVQPDGVLADVEAEFQVDAGCLAPRG
GKHVTAKAVGPSGTAVPVDLKDNRDGTYDAKYSPYEKGPHQVIVDYDDVPVPGSPFNVGV
DEGCDPTKVKAYGPGLEQGTTAKPAKFMVDTRGAGTGGLGLVVEGPSDAKITCTDSKDGT
CAVEYLPTAPGEYEVNITYGGENIPGSPFIVPVKDTVDPTKVSCNGPGVSPGVRANVPQE
FTVDCSTAGVAPLDVAVKGPKGLKEPVDVRDNGDGTHTVKYTPTKEGPYQVQVKYADHEI
PRSPYRVRVQPTHDASKVKCNGPGIASGGVPASLPVEFTIDATDAGDGVLAVQITNPKRE
KYSVEMPPAPKKPTGSEGVGPGARSPKRKSPSKSHSPTKTRPGRGSRGSEDSPGRKSRSR
SGSSSSSSSSSRSRSRSSSSSSSSSESDSPKASSPTKGSPRKSASGTGEPYERSPRKRGG
VKSGAKDSPCREVHASDPEGRPKRASVRDNGDGTYSVSYIPDTVGRYTISVKYGGDEIPY
SPYRIRAVPSGDANKCLVSVCFGTAGDGLGPNIYIGEEAVITVDPNGAGPGNVTCAVTTP
DGEKLDADVVQNKDGTFDIFYTPKEVGPYTINIHFGGEEVPNSPYRVTAVPGLKPAPVVE
EDFQQTAVAPAYSYMNGSEPAIEQVDGPDSLRPVQLVFEVPSRPGNLTSEVTTPSGIKES
PVIKNNGDGTITVQYQPHEPGLHEMAILLDNEHISGSPIQFYADVMAPGHVTAYGPGLVT
GKVDEPANFTIVTKDAGAGGLALAVEGPSKADITCQDNKDGTCSVTYLPTAPGEYTVTVK
FDDQHIPGSPYTANISGGADQRKSKLSYGTTSDVALKINESDLSLLSASIEAPSGHKESC
VLKKLPNGHIGISFTPKEIGEHLVSVKKRGRHIANSPFRIMVGESEIGDASKVKVYGDGK
ESACAGETAVFMVDTRQAGYGGLGLSIEGPSKVDINCEDMDDGVCRVTYTPQEPGNYVIN
VKFADKHVPGSPFTVVCTGDDSPQKKGSILRQQKAASVATVGSTCDLNLKIPNNWMDLMS
SGAKSTRHASSFSQSYSRVEQSSFRSTGVSSQSQSMVRESFSPSSQSSHSLLTSSASPFV
PKFTSSQGKFGTFEHSLKATGAGLADLSAEVKSPCGDIQKAEIVETDENTYSIRFIPKEM
GVHTVSVRYMGQHVPGSPFEFTVGPLGEGGAHKVTAGGPGLEGAVVSVPADFSIWTREAG
AGGLSIAVEGPSKADINFEDRKDGSCGVSYVVTEPGDYEVNVKFNDQDIPGSPFPVTVTG
VGKNTKDPQRFKSDASKVRSYGSGLRRAVIGENTFSVDCCNAGSNMLLVGVHGPLTPCEE
VHVKHVGQRKYAITYTAKEAGDYLLIVKWGDDHIPGSPFHVKIP
NT seq 8775 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccacagtagcgaagtagtttacgttggtgacaactacgacgaggacatgccg
gccaccgaacgtgagctagctgaagacgcaacatggaagataatccaaaagaatacgttt
acaagatggtgcaatgagcatctcaaatgcatcaacaaaagagtagccaacctggagact
gatctttccgatgggcttaggctcattggtttgattgagatcctctcccagaaaaagatg
ggaaagcacaacaagagaccaaacttcaggcagatgagactggaaaacgtctcagtggcg
ctcaactttctagaagctgagaggatcaagctggtcagcatagacagcaaggctattgtg
gatgggaacttgaagctcattttgggtttgatatggactctcattctgcattattccatc
tctatgcccatgtgggacgaagaagaagaagtagaagaaaagagtaaagccactcccaag
cagagacttctgggatggatacagaacaaagtcccgcaaatgccgatcactaatttcaaa
ggcaactggcaggatggtacagcacttggtgctttggttgataactgcgcgccgggcttg
tgccctgactgggaggattgggatccgaacaacccaatggaaaacactgccgaggcgatg
aaattggcagacgaatggttaggcgtaccacaggttatcacgccagaggaaatcactaac
ccccacgtggacgagcttagtgtaatgacttatttgtcgcaattcccgaaagcgactttg
aagcctggtgcacctctgcgaccaaaaacaaacggaaagaaagcaagagcttatggcaaa
ggtattgagcccaagggttgcaaagtgggttcccctgcaccatttactgtggaaactgtt
tctgctggttccggtgaagttctggtttacctgaccaaccctgaaggccacaagactgaa
ttgcaagccacccccaacaacgacaagcttaaaacgtactctgtgacttactatcctgat
atgccaggagactacgaggtaacagtcatgtttgccggtgtgggaatccataagagcccg
ttcaaggtttacgttgatgattctcccgctgacccgagcaaagttgtggcgaaaggaccc
ggccttctacctggaaatattgtaaaccatcctacacatttcgatgtgattacaacagac
gctggagcaggagacgttaacgtggtcatcgaagacccgactggttgtaagcaatcggtt
cgacctaagatcgagaagcaaggagaaacttacaaagttacctatactccatctaagaac
ggaccgcaccacgttcatgtattgtttgctgatgcaccgattaataagagcccattcgaa
gtgcccatctcactgcctcttaacccatcggcagtttgggcagaaggacccggagttgaa
ccaaacggattaaccgtccgccaagtcgcaaattttgatgttcacactgaacaagctgga
gacggcaagttagaagtcaaatgcatcggaccacgaggcgtgaccgagaaagtgaacgtg
aataacaacggagatggaacttactcgtgcgactattacccaaccaaaccagggcaatac
gtcgtgggtgtgacctattctggcaaggctgcgtcaaacagcccatacagggttaacgtt
gatgtgccgcctgacgcaagcaaagtcaaagtacaaggcccaggaatcgaaccaggcaat
gtggttggggaaccaacatattttgatgtgctgactgcagctgcgatgccccggtcttac
ccaaagcctgctggtaagggtagatccagttattcaagaccaatgaatggccatgttgga
aaaccactttcagatgctggaaaaggagatgtacgtgtatctgttattggacctgatggc
actcagtcacctgatgtgccaatgtcacttgaagagcgtcctaacagcactgtacgagcc
acatacaccccccaggtgcaaggaccccacaaggtgtacgtcgaatttgttggagaacaa
gtaccaaggagtccataccacgttgacattgcaccaggcgaggttattgaacctatgatg
gtatctgaacaaaatgctcctgtttttcttgaggcatctgaccaaatgcctgtagaggaa
atggtccaacccattattgaagagcctgtacaggctgtacaagtggctagaccaacagaa
caatctccagctttcaatgccaatgcatgccgtgcttatggcagaggaattcaacccact
ggtcttcgtatgcgggaaaaagcagacttccatgtaacaactaaagatgctggtgacgca
gatcttaaagtcacagtcaaggggccaaggggaagtaacgaacctgtgacagtaaagaaa
aatcccaaagagcctgaagtgtttgattgcgagtattacccactaaaacaagggaactac
accgtcgatgtcacatttggaggaaaaccaattccaaaaagcccattcgagatattagtt
ggtcctgaagcaggcgcgcaaaaagtgagagcttatggtccaggtttgcatggtggtaaa
gttggtcactctgctgattttgttgtggaaactattggaactgaagtcggacagcttggg
ttctcaattgagggaccatctcaagccaagattgaatgtgaagattgtggcgatggttca
tgtgatgtgaaataccacccaactgaaccaggagaatatgctgtacatgtcgtatgtgat
gataatgatatcaaaggttctccattcatggcacagattgcccctgctgataccaagagt
agacctgacatggtcaaagcctacggtcctggtcttgaatctggtacccccgttaacggc
cgccctaccaactttactgtcgacgcaaagcgagcaggagctcctgcccccgtcgaggtc
gtagctgttgctgcagatggagagaatctgccagtgaaagtgaaagataatggagatggg
acttatgactgtgactacacacctaagaatccaatcaaacacaccattattccatcttat
gatggtgttgctgtgaaggacagcccattcagggttaacgtcaatgaagactcttaccct
gacaaagtaaaggtgtatggaccaggagttgaaccaggtcttaaagcagaagagcccacc
tacttcacagtggattgtgcaagagctggtaatggagatgttagcattggtatcaagtgt
gcagctggagtggttggacctacagaaagggatgttgaatttgaaatcattaaaaacgat
gcttcagacacttttacagtgaaatacacacctccaggcccaggtgagcacaccattatg
gttctgtttgctgaacaaccagttccaaaatcaccaatcacagtaaatgttgcttcgtca
cataatgcaaagaaagtcaaagctgatggaccagggattgaaaaagaaggtgttgaatgc
ggcaagcccacccactttaccatatacaccaagggtgctggaaaggcaaaaccaaatgtt
caattcaaaccagccagaggttcatataagcctccagcaagcaaggctgacattctggat
aacaaagacaatacatacactgtgtcctacacacctcacgcggaaggaccaatggacgta
gaagtaacttatggtggggataagattcctaactctcctttcccagttgatgttgcacca
gctttagatgtaaacgctgtcaaagtcaaaggccttgaagacaaaatggatgttggaaaa
ccacaagagtttgaggtcctcaccaagggagcaggaggacaaggaaagttggatgtggat
gttgttggaccttctaatcttccaatacatgttcacgataagaagacacctaacgggaag
aaatgccattttactcctgtagaagaaggtccacacagagtgaatgttgcgtacgatgga
attcccgtccgtggaagtcctttcttggtggatgctttgacccccgctgaccccagcaaa
gtccgagcatatggccccggtctttctggtggggtggtcaaccaatctgcaccctttacc
attgaaactgcagatgcaggcaatggtggtcttggacttactgttgaagggccctgtgaa
gctaaaattgaatgcattgataatggagatggttcatgctctgtggcatacatgcctaca
gaggcaggagattacaagattaatgttttattcgctgataaacatattccaggatctcca
ttcaatgctaaaatcgagccagcgtttgatgcttctaaggttgatttaagcgggccaggt
cttgaaagtggaaaaataggaaagccaagcaagatatgcgctgattgctgcagtgctgga
gacgcacctcttacagcagatgtgctaaacgatgacggaactaaagttcctaccaaggtt
aaagataatggagatggaacacatgacatcacatttgtgcccaacaagccaggcaaggca
ttagtgaacgtacaatatggcggcatctccgtgcccaagtcaccagttagtgttccaatc
aaaccagatgtggatacaagtggagtcagaactactggccctggtgtccaacctgatggt
gttcttgctgatgttgaagcagagtttcaagttgatgctggatgtctcgctccacgtggg
ggtaaacatgtcaccgctaaagctgttggaccatctggaactgcagttcctgttgatttg
aaagacaatagagatggaacatatgatgcaaaatactctccctatgaaaaaggtccccat
caagtcattgttgactatgatgacgtcccagttcctggatctccgtttaacgttggtgta
gatgaaggttgcgaccctaccaaggtaaaagcatatggtccaggcttggagcaaggtact
acagccaaaccagccaagtttatggtggatacaagaggggctggaactggaggtcttgga
cttgtcgttgaaggaccttctgatgcaaaaattacatgcactgatagcaaggatggaaca
tgcgctgtcgaatacctaccgacagcacctggtgaatatgaggtaaacatcacctatggc
ggggaaaatatacccggatctccattcattgtccctgtcaaggatactgtggaccctacc
aaggtgtcatgcaatggacctggagtatctcctggagtgagagcaaacgtcccacaggag
ttcacagtagattgctcaactgctggtgtcgccccattggatgttgctgttaagggacca
aaaggtttgaaagaaccagttgatgtccgagataatggagacggaacacacactgttaag
tacacccccaccaaagaaggtccgtaccaagtccaagtgaaatatgctgaccacgaaatc
ccaagaagtccataccgtgttcgagtacaacccacccacgatgctagcaaggtcaaatgc
aatggaccaggtattgcatcaggtggtgtgcctgcatctctgcctgttgagtttaccatt
gatgccacagatgctggagatggtgttcttgctgttcaaatcacgaatccaaagcgcgaa
aaatactcagttgagatgccacctgctcccaaaaagcctactggctctgaaggggtgggc
ccaggtgctcgttctccaaaaaggaagagcccaagcaagtcgcacagcccaaccaaaact
cgacctggtcgaggctctcgtggaagcgaggatagtcctggaagaaagagccgaagcagg
agcggatcaagctccagcagttcctctagtagtcgctctagatcaagatctagctccagc
tcaagttccagctctgagtccgacagtccgaaagcatcaagccctaccaagggaagccca
agaaagtcggccagtggaacgggagaaccttatgaacgcagcccacgaaaacgaggtggc
gttaagtcaggtgcaaaggattcaccatgcagagaagtccatgcctcagaccccgaaggc
cgcccaaaaagagccagtgtgcgtgacaacggtgatggaacatattctgtttcttacatc
cctgatacggttggtcggtacaccatctcagtgaaatatggaggggatgaaataccttat
tcaccatatcgcattcgagctgtgccttctggggatgcaaataaatgccttgtatcagta
tgctttggaacagctggagatggccttggtcccaacatttacattggagaagaagctgtg
ataactgttgaccctaatggtgccggacctggcaatgtcacgtgtgcagtcaccacccca
gatggtgaaaaactggacgcagacgttgttcaaaacaaagatggcacttttgatatcttc
tacacacctaaagaagttggcccgtatacaattaatattcattttggcggggaagaagtt
cccaacagcccatacagagttacggctgtgcctggcttgaaacctgcaccagtggtggaa
gaagatttccaacagacagcagtagcacctgcctactcttacatgaacgggagtgaaccg
gcaattgaacaagttgatggtccagattcgctccgacccgtgcaacttgtgtttgaagtg
ccttccagacctggaaaccttaccagtgaagttactacaccaagtgggattaaggagtct
ccagtcatcaagaacaacggtgatggaaccatcactgtacaataccagccccatgaacca
ggactgcatgagatggccatcttacttgataatgaacatatctcaggaagtcccatccaa
ttctacgctgatgtcatggcccctggtcatgtgacagcatatggacctggacttgtgact
ggcaaagttgatgaaccagccaactttacgattgttaccaaagacgctggtgcaggtgga
cttgcacttgctgtggaaggcccatccaaagcagacattacatgccaggataataaagat
ggcacatgttctgttacttacttaccaactgcaccaggagaatacacagttactgttaag
tttgatgaccaacacataccaggatctccatacacagcaaatatctctggtggagcagat
caaagaaaatcgaaactttcttatggaacaaccagtgatgttgctcttaaaatcaacgag
agtgatctctctcttctctcagccagcatcgaggcaccatccggacacaaagagagctgc
gtacttaagaaattgcccaacggccatattggcatctcgtttactcccaaagagatcgga
gagcatctcgtgagcgtgaagaagagaggtcgtcacatcgcgaactctcccttccggatc
atggtaggagagtccgagattggagatgcaagtaaagtaaaagtatacggagatggaaaa
gaaagcgcttgtgctggggaaacagctgtgtttatggtggatacaagacaagctggttat
ggcggtcttggtttatcaattgaaggtccaagcaaggttgatattaactgtgaagatatg
gatgatggcgtatgtcgtgttacatacacaccacaagaacctggaaactatgtgatcaat
gtaaagttcgcagacaagcatgtacctggttctccattcactgttgtgtgcactggcgat
gacagtccacaaaagaaaggaagcattctgcgacaacagaaagcagcttccgttgctaca
gttggtagcacttgcgatcttaacctgaaaataccaaacaactggatggaccttatgtct
tctggagcaaaatccacacgccacgcctcctctttcagccaatcatacagcagagtggag
cagtcctcttttaggagcacaggagtgagcagccaatcacagtccatggttcgggagagt
ttctccccctcctcccaatcctcccactctctcctcacttcctccgcttctccttttgtc
ccaaaattcacgagcagccagggaaaatttggcactttcgaacattctctaaaagcgaca
ggtgctggcttggctgatttatctgctgaagtaaaaagcccatgcggagatatccagaag
gcagaaatagtagagactgatgagaacacatacagtattagattcataccaaaggaaatg
ggcgtacacactgtcagtgtgcgatatatgggtcaacatgtacctggaagccccttcgag
ttcacagttggacccctcggtgagggtggggctcataaagtcactgctggtggtcctggg
ttagaaggagctgtcgtcagtgtaccagctgacttcagtatatggacacgcgaagcaggc
gccggtggtttgtccatcgcagtagaaggaccttcaaaagcagatatcaactttgaagac
agaaaagatggttcttgcggtgtgtcgtacgtcgttactgaaccaggcgattatgaagtg
aatgtgaagttcaacgaccaggacatcccaggtagtcctttcccagtcactgtcacaggg
gttggaaagaacactaaagacccgcaacgctttaaatcggatgctagcaaggtcaggtcg
tatggaagcggtctcaggcgagctgtgatcggtgaaaatactttctccgtcgattgctgc
aatgcaggcagtaacatgctcctggtcggcgttcacggcccactaaccccatgcgaagaa
gttcacgtaaaacacgttggtcagcgaaagtacgcgattacatacacagccaaggaagcc
ggcgactatctgcttatagtgaagtggggtgacgatcatattccaggcagtcctttccat
gtcaaaatcccgtga

DBGET integrated database retrieval system