KEGG   Ciona intestinalis (sea squirt): 100186554Help
Entry
100186554         CDS       T01056                                 

Definition
serine/threonine-protein kinase minibrain-like
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100186554
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100186554
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 815 aa AA seqDB search
MIVEQDRRVVDSLIPCSVFNRSPEPGVNWRSSPTSEVMWNSSVTVGNPPSYNNHVSWNAL
SSCRIDWFNSKTGRVEGVTRPSKTSAVQVHDQAAKSYDHEQVPWSGDYAADNDDVLSHCS
AAHSRGNKPSSKNPFTALLAPLGSIALSEEGCRDCTRLRSNRRHPQHKMAQGGQEMQHQF
YAQQQKEQMARIPGSFRESNTAPTRKLSVDLIKTYKHINEVYYAKKKRRAQQQSSEETRP
QKERRVFNDGYDDVNYDYIIKNGEKWNDRYEIDSLIGKGSFGQVAKAYDHEEQEFVAIKI
IKNKKAFYKQALIEVRLLELMNRYDSDNKYYVVRLKRHFHFRNHLCLVFELLSYNLYDLL
RNTNFRGVSINLTRKFAQQLCTALLFLSTPEINIIHCDLKPENILLCNPKRSAIKIIDFG
SSCRLGERIYQYIQSRFYRSPEVLLGIPYDTAIDMWSLGCILVEMHTGEPIFAGSNEEDQ
MNKIVEVLGMPPQHMLDSASTQKVRKLFERNQDGTWRVKKQGKKYKDPGSRKLHDILGVE
TGGPGGRRAGEAGHTEQDYLKFKDLIQRMLTYDPKDRLTPFYALQHSFFKKTADGSTNTS
SSPAQDLSSSSTGSSSSSGRARSDPGAHPVFTTTAEISASYISPSNNASSSKMSHSKPTQ
GPNPSYPQYPTASTQLPGGIYPSPSSPSHTRNNGQHYLTSQPQPFGTIQGGGPFNPHYGT
SSPPQTLPSSYYQPSLPGSTGDMVPLSLQAPTVLIPKHQLLPPTMVPPLLPMDFGQQPMN
RMNNQTTQGYHARTHSQQDSPMTGVQVQQSPVPSS
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgattgtggagcaagatcggcgagtcgtcgacagtctgatcccgtgttcggtatttaac
cgttcgccggaacccggggtcaactggaggtcatcgccaacgtcagaggtcatgtggaat
tcatctgtgacggttggaaaccccccttcatataacaatcacgtgtcctggaacgcatta
tcttcgtgtagaattgactggtttaacagcaagacgggtcgcgtggaaggagtgactcgt
cctagtaaaacatctgccgtacaagttcacgaccaagccgcgaaaagttacgaccacgag
caagtcccatggagtggtgattacgctgccgataatgacgatgtcttatctcactgcagc
gccgctcattcacgaggtaataaaccaagcagcaagaatccctttactgcattactggca
cctcttggttctatagcactttcggaagaaggttgtcgagattgcacgcgtctacgctcc
aaccgacgccacccccagcataagatggcacaggggggacaggaaatgcaacatcaattc
tatgcacaacaacaaaaggagcaaatggcaagaattcctggttcgttccgtgaatcaaac
actgcaccaactagaaaactctcagtggatttgataaagacatacaaacacatcaatgag
gtttattatgcaaaaaagaaaagaagagcacaacaacaaagttccgaggagacgagaccg
cagaaggagcgtcgtgtgtttaacgatggatacgatgatgttaattatgattatatcatt
aagaatggggaaaaatggaacgaccgatatgagattgattctttaattgggaaaggttct
tttgggcaggtggccaaagcatacgaccacgaagaacaagagtttgtcgcaatcaaaata
atcaagaataagaaagctttttacaagcaagccctcattgaagttcgcttgcttgagtta
atgaaccgttacgacagcgataataaatattacgttgttcgtctgaagcgacatttccat
ttccgcaaccacctgtgtctcgtgtttgagcttctatcatataatttgtacgatttgttg
cgaaacaccaatttccgtggggtctctataaacctcacaagaaaatttgcacaacagtta
tgcacagcgttactttttctctccacacctgaaattaacatcattcactgcgatttgaaa
ccggaaaatatcctcctttgtaatcctaagcggtcggcgattaaaattattgactttgga
agttcctgtcgactgggagagagaatataccaatatattcaatcccgtttctatcgatct
cccgaagtgttacttggtatcccgtacgacacagccattgatatgtggtcactgggctgt
atattagttgagatgcatactggagaacctatctttgcaggatctaatgaggaggatcaa
atgaacaagatcgttgaagtattaggaatgccacctcagcatatgctcgattctgcttcc
actcaaaaagttcgcaaattattcgaacgaaaccaagatggaacgtggagagtcaagaag
caaggaaagaagtacaaagatcctgggagtcggaaactacacgatatccttggagtagaa
acgggaggacctggaggaagaagagcaggggaagcgggacacacagagcaagattatctt
aaatttaaagatttgatccagcgcatgttaacttacgacccaaaagatcgtcttacccct
ttctacgcgttacaacacagtttctttaagaaaaccgccgacggttcaacaaacacgtca
tctagtcctgctcaagacctcagcagttcctctactgggagcagcagttctagtggcaga
gcacgttctgatccaggagcccaccctgtgttcacaaccactgctgagatatcagcttca
tacatctccccatctaacaatgcaagctcgagcaagatgagccacagcaaacccacccaa
ggacccaacccctcctacccccaataccccactgcgtccactcaactgccggggggtatt
tacccttctccctcctcacccagccacaccagaaacaatggacagcattatcttacctcg
caaccccaacccttcggtactatacaagggggaggcccctttaacccccattatgggacc
tcgtcacccccacaaacgttaccctcctcctactaccaaccctcactacctggtagtacg
ggtgacatggtccctttaagtctccaagctcctacagtgctgataccaaagcaccagctg
ctccccccaacaatggtaccccctctgttacccatggactttggccagcagcctatgaat
cgcatgaacaatcagaccacgcagggttaccacgcgcgaacgcactcgcaacaagactct
ccgatgacgggagttcaggttcagcaatctcccgtcccgtcgtcgtga

DBGET integrated database retrieval system