KEGG   Ciona intestinalis (sea squirt): 100186761Help
Entry
100186761         CDS       T01056                                 

Definition
histone deacetylase 1-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100186761
Enzymes [BR:cin01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100186761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 569 aa AA seqDB search
MALSNPGGSRKVCYYYDSDIGNNYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKC
NAEEMSRYHSDDYIKFLRSIRPDNMSEYTKQMQRFNVGEDCPVFDGLYEFCQLSGGGSIA
GAVKINKHQTDIAINWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYALNFPLRDGMDDECYEQ
IFQPVITKVMEYYQPSAVVLQCGADSLXGDRLGCFNLTVKGHAKCLEYVKKFNVPILMLG
GGGYTIRNVARCWTYETAVALGQEIPNELPYNDYFEYFGPDFKLHISPSNMSNQNTMEYL
QKIRQRLFENLRMLPHAPGVQMQDIPPDAVVSGSDDEAMDDPDKKTSIRASDKRIQRPDE
YSDSEDEGEGGRKNEETHKKKRKVIEVEGVAQPQETKPAPVAEPATENGVDKPEPTKEAL
DTSVPASTTEPVETTPVTVPDDVSTKDAVVPEASEVQNENVAQPETTSETPVVQNEEKEA
AAPPSEEVAQAPDSTTPDEEKQEDEKMEI
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcgttatccaaccctggaggcagtcgaaaagtctgctattattatgactctgatatt
ggtaacaactactatggtcaaggccacccaatgaaaccacacagaattcgcatgacacac
aatctccttcttaattatggattgtacagaaagatggagatctatcgtccccataaatgc
aatgctgaagagatgtcacgataccacagcgatgattacattaagttcctgagaagcatt
cgtccagataacatgtcagaatacacaaaacaaatgcagcgatttaatgtgggtgaggat
tgcccagtgtttgatggcttgtatgaattctgtcaattatctggtgggggatccatagct
ggtgcagttaagataaacaaacaccaaacagacattgcaatcaactgggcaggcgggctt
catcatgcaaagaaatctgaagcatctggattctgttacgttaatgatattgttctggct
atcctggaactactaaagtaccaccagcgtgtcttgtacattgacattgacatccaccat
ggagatggggtagaagaagccttctataccacagatcgtgtcatgacggtttcatttcat
aaatatggagaatatttcccaggcactggagatctaagggatataggggcagggaaaggc
aaatattatgctcttaacttcccactaagagatggaatggatgatgaatgttatgaacaa
atctttcaaccagtgataactaaggtgatggaatattaccagccaagtgctgttgtactt
cagtgtggggcagattcattgncaggggataggcttggttgtttcaaccttacagttaaa
gggcatgctaagtgtcttgagtacgtgaagaaattcaacgtcccaatcttaatgttgggt
ggaggtggttacaccattcgtaacgtagctagatgttggacatatgagactgctgtggct
ctggggcaggaaattccaaacgagcttccctacaatgattactttgaatactttggacca
gacttcaagcttcatatcagtccaagcaacatgagcaaccaaaacacgatggaatatttg
cagaagatccgacaacgattgtttgaaaaccttcgaatgttgcctcatgcacctggcgtg
caaatgcaagatatcccaccagatgctgttgtatcaggaagcgatgatgaagcaatggat
gatccggataagaagacatccatccgagcatccgataaacggatccaacgtccagatgaa
tactccgactccgaggatgaaggagagggcggaagaaagaatgaggaaactcacaagaag
aagaggaaagttattgaggtggaaggtgttgctcagccgcaggagactaaaccagctcca
gtagcggagcctgccacggaaaatggagtcgataagccggaaccaactaaagaagcttta
gatacaagcgtgcctgctagcactacagagcctgttgaaacaactcctgtgactgtacct
gatgacgtaagcaccaaggatgcagttgtgcctgaagcaagtgaagtccaaaacgaaaac
gtcgcccaacccgagaccacaagtgaaacccctgttgttcaaaatgaagaaaaagaagca
gcagcgccacctagcgaggaagtagcacaagctccagactccaccactcctgatgaagag
aagcaggaagatgaaaaaatggaaatttga

DBGET integrated database retrieval system