KEGG   Ciona intestinalis (sea squirt): 100186785Help
Entry
100186785         CDS       T01056                                 

Gene name
si:ch211-218c17.2-like
Definition
choline/ethanolamine kinase
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100186785 (si:ch211-218c17.2-like)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     100186785 (si:ch211-218c17.2-like)
    2.7.1.82  ethanolamine kinase
     100186785 (si:ch211-218c17.2-like)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 378 aa AA seqDB search
MASALLPKRKPGPDDMDMVKENIRVDVVSRAYQLCKEYLDGPWSQISIHEFEITTLGGGL
TNKLYICNLPPKYRSNDNDSCYPNTVLLRLYGLILQDFKAQIQESVVFSILAERKVGPKL
YAVFPGGRLEEFLPSRTLKTSDLFDPSTSRHIAQRMVEYHSLQMPVKKEPTFIISKLYTY
FENAKSAEFSDEYKQSLYLKLMACNIEAEVQFVTRIISKQDVVVFCHNDIQEGNLLQSIR
DDQNNPVQMIDFEYSSYNYRGFDIANHFCEWMYDYSYSSWPFFSYKFEHYANQQQQANLV
EVYLEESYRVRPSRRSDPKWQKAYIMDEIKRFSLLSHIFWALWSVVQAQISDIGFGYMEY
ALARMDAFFKHKELVTQK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgctttgctgccgaaacgtaagccaggtccagatgacatggacatggtgaag
gaaaatataagggttgatgttgtctctcgagcttaccaactgtgcaaagaatatttggat
ggtccctggtctcagatctcaatacacgagtttgaaatcactaccttagggggtggttta
acaaacaaactgtacatatgtaatttgccaccaaagtacagatcaaatgacaatgacagc
tgttatccaaacacagtccttctgcgactctatggtcttatcctacaggatttcaaagct
caaatacaagaaagtgttgtgttttcgattttggctgagagaaaggttggtcccaaactc
tatgctgtgtttcctggtggacgacttgaagaatttttaccaagccgtaccctaaaaact
tctgatttatttgatccaagtacatctcggcacattgcacaaaggatggttgaatatcat
tccttgcaaatgccagtaaagaaagaaccaacttttattatctccaaactgtacacgtat
tttgaaaatgcgaaaagtgccgagttctcggatgagtacaaacagtcactctaccttaaa
ctaatggcatgcaatattgaagctgaagtacagtttgtaacaagaataatatcaaagcaa
gatgttgttgttttctgccacaatgacatacaagaaggcaacttattgcagagcatacgt
gatgatcaaaacaaccctgttcaaatgattgactttgaatacagcagttacaactatcgg
ggttttgacatcgccaaccacttttgtgagtggatgtatgactacagctactcttcatgg
ccattttttagttacaagtttgagcattatgctaaccagcaacaacaggcgaaccttgta
gaagtttatctagaagaaagctatagagtgcgcccgtcaagaagaagtgacccaaagtgg
caaaaagcttacataatggatgaaataaaaaggttctctttgttgtctcatattttctgg
gccctatggtccgtggtacaagctcagatctctgacattggtttcggatacatggaatat
gccttggcacgaatggatgctttttttaagcacaaagaacttgtaactcagaagtaa

DBGET integrated database retrieval system