KEGG   Ciona intestinalis (sea squirt): 100186790Help
Entry
100186790         CDS       T01056                                 

Definition
(RefSeq) histone acetyltransferase KAT6A
  KO
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100186790
Chromosome [BR:cin03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100186790
   HAT complexes
    MOZ/MORF complex
     100186790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
12
AA seq 2554 aa AA seqDB search
MLRSASTAGPKSPDIDIGVLNDSILETIRRIRAQKQRPSLERISKWVMNRTPAKGCTYAE
VINQLEELSSTGKVLKVFNQGEYSYRDPETMTPRACGRAPKSLTKVGTTPKYGRVTTPKS
PIGSPSSPKIATPEITLIPQDQLRRHKTIQVSDYIKLVQIVLDGLQQPEGASIKDMEKYL
ETTYYIQGISPLEFSRHLRLACKRGLHAGRLIKDGLLFRLSPSAPYNNNNNVQALQSSPT
ILQEENNDLPRATPMPICSYCYGTAECNKTGKQEELLSCADCGSSGHPICMKLSSDLVPK
IRGSRWQCIECKSCRVCGSKGNADNLLFCDSCDRGFHMECCNPPLLKMPKGSFICELCNE
NSTSSSVSKIPLSKCRRTPAAQRRLISSDSSTGPMAQSLGSSPPSTTCEVFGDNGKHFLQ
VPFHKKPKGLIDGMTRFFTPSVGRRKTMTSQARTTQLMIIHNTSSDNNSSSKEEDILSKN
SSNEKSCKANITELDESMFFKAREESFQRTGMVEGETPDPSTTRCPAAIEFGKYSIETWY
SSPYPQEYARLPKLFLCEFCLKYMKSHTILQRHARKCPWFHPPANEIYRSNNLSIFEVDG
NVSKIYCQNLCLLAKLFLDHKTLYYDVEPFSFYCLTINDSKGCHLVGYFSKEKHCQQKYN
VSCIMTMPQYQRQGYGRFLIDFSYLLSRKEGQAGSPEKPLSDLGEVSYNAYWRSTLLDYF
SKQLNEKNISLRDISKSTGICPHDIAMVLQKLGMISVTPGGASEEEVVDAIKFNLKRRRK
MVMEYIKKKQQRDNDSTRPPRPTVDSDCLRWTPLISSNSWGSDESVLKSPSTTPEKIRPS
TEQKTSINGTSHVAEEHIEATEDANVDPEAQEDAEEDGEQHPHQENNTTENVANDVDLCE
SIDYFEDKNEPVEQHDDKMSDTSSSNEKSGAKRRGRPRKSFPSDSVFPLTKDVSVTSQCD
ATSLSSSFSPLRKRRKRKVKGYPWGRIKSRKKKKKISEKSSEKTQSDAEPSATGSGWRLG
GPHLSSESETEINDADERESEANSARAASHDDTLSFETTSASGASKDTESDDETFVPIVA
KGRILPRKKGRRRKSKGYQWGAIRRKIKKPVCQKLGNGSPVKSPKRPGRPRKMLLSPKER
ENTPPQPSKSPTPASPVKSTKQTTMDRFFRRKCEPKVAEGKESLKQLNCNGNNVKQQDSE
TKSTNLYDALKDSTHVVVASVTVSPAKRLRSPSFSQPTLSSLKQQEYESPEPKRRRRSAI
AGENFVASCILSSRSPRRPHERSSKDNSSSDEDAGPQEEESKCTDTQLNQGFPVLGENKV
LNRTFLGLCPQDQSNSLLNPLNKSENQVSTVAFAKPWISTLSSGTANTAQSQRSSFSLPN
EGGFNMMSFRSANIQHQQKKSSGSKVTLRPSSLTVYRDMTRSNLDEDNDPSSSSSSDADS
SCSSSAESSSSDVEADFVATENFDLQWRGQEKAKKLSKRKSNTQKCHKLKSHQLLDSNST
DDVATSDQVKEKDTTEMKDYGLGATNRGGGEEKKVGMVKRGRGRPRKNPVAPLNPEKLAE
KPKLKKRGRKPKQEKDLPSKGGIKLTVMRTEDGYHTTNSVSGSSSEKITEGPQIDEDDLV
DLKEVKEIEEEQRIKDESEPDGLVKKMGSPGQDDSKSWCDYESTGGSAGSDSEVTTEKEE
KLLKRNGDPTLPKWDPNSTKGNPDSWDINPESPAKESSFSDSQPTSIADVIDESSLGTVF
PAVDEIRPSSALAAEIAMRAENEQKAATGFIEATNDNMVDNDALPDVKNDRIIPFQMDRN
ISTTKEEQREISAAVASIIPDNQDSPIDLEYSEVLENYEQSSTDVGNEGETKIEEEEEES
EVVMENKENESSSSDITLNTTLVADIGEDLNQNVPSSFPQDSNITSSIPTNFTDCNFSKK
SLETFDIQSNTSKQLTTEGQSYTDIEQDINSNSQYKTCNNTDVSTPLLQQCRYNQEYNAP
ISAHDTTTFQSTNTGTQFQSNSSYTNSYPQQQMYHDNMQYQNSYTNNRVAIYDTSCTLNK
GARQEQPMQMDQPHMVGQTQKGNYQGVIPCPSTRLEYTHTGVDVGQMPAPCPPGAVQGPS
NHTHGHVFPNGAAGADFGSSSGYETLSNNSCSPYTSPDSIPSINPSSCDHSGQSMVPNQH
PDPTYSSPQSSVSVVGMGQSTTAAPPIIYSAPSNDSGHGSEYLASPTNHGLLSCQGTPPK
PPSGTVLSPDPYYVNKKQSTSPNRPSCAVTSSAGFAHVNQRMSPCAQPACNSYDESRTQD
RTKDLTRANSLLELQKLTHKVSCQPNKTPTYPTGSPAFQKPDNYDLNQKMPQYSTGDRPA
SVQSVPGEMCQPHTTVTTPSHPADNSTTQATYHGHRPEQKQHGSYKNEASYHPGYRAGPE
HVPGHPWPPHSQIWPRQPGGYGPFTHHAPTYEQWHGGFGGYPSYPSQGASCQFESQYRLN
PNPTNDLAAGSSGSYHTSNKLTPNPLLVPRLPGQPYPREPESYQRPPVGYDPLASRNGVF
NPNDTSNRRIGYHNQPYNAYPQNPGTYYNPYMYG
NT seq 7665 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaagtgcctccacggcgggtcctaaaagcccagacattgatataggtgttcta
aacgactcaattttggaaacaattcgaaggattcgtgcccagaaacaaagaccttctctt
gagcgaatatcaaaatgggtgatgaatcggacccccgcaaaaggttgcacatacgctgaa
gttattaatcagcttgaagaactgtcttcaactggaaaagttttgaaggtttttaaccaa
ggtgaatattcctaccgtgaccctgaaactatgacaccaagagcttgtggtcgtgctcct
aaatctttaacaaaagtcggtactactcctaaatatgggcgggtaaccaccccgaaaagt
cccattggttcaccatcatcacccaaaatagcaacacctgaaattactctcattccccaa
gatcaactaagaagacataaaactatacaagtttccgactacattaaacttgtacaaatc
gttttggatggtttgcaacaacctgagggagcttcaattaaagacatggagaaatacctt
gagacaacttactacatacagggaatctctcctcttgagtttagtcgtcatttgaggtta
gcatgcaaacgcggattacatgcgggtcgtctcatcaaggatggtttgctcttccgatta
tctcccagtgccccatacaacaataacaataacgtgcaggcattgcagtcttctcccact
atcctacaagaagaaaacaatgatttgccgagggcgacaccaatgccgatatgtagctac
tgttatggaactgctgagtgcaacaagactggcaagcaagaggaattactttcttgtgca
gattgtggaagcagtggacacccaatatgtatgaagctctccagtgaccttgtgccaaaa
attcgtggttcacgttggcaatgtattgaatgcaagagttgcagggtgtgtggctccaaa
ggaaatgcagacaacctgcttttctgcgattcttgtgacagaggattccacatggagtgt
tgcaacccacctttgcttaaaatgccaaaaggatcattcatatgtgaactgtgcaatgaa
aactcaacttcaagttctgtatcaaaaattccactttcaaaatgccgacggacaccggca
gcgcaaaggaggcttatttccagtgatagttcaactggaccaatggctcaatccttaggt
tcttccccaccaagtacaacttgtgaagtttttggagacaacgggaaacatttcttacaa
gttcctttccataagaaacctaaaggtctgatagatggaatgacaaggttctttacccca
tcagtaggtcgacgtaaaacaatgacatcgcaagcacggaccacacaactcatgatcata
cacaacacaagcagtgataacaactctagttcaaaagaagaagacattttatcaaaaaat
tcaagcaatgagaaatcatgcaaagcaaacatcacagaacttgatgaatccatgtttttc
aaagcaagagaggaatcttttcagcgcactggtatggtagaaggggaaacccccgatccg
tcaaccactaggtgtcctgctgcgatcgagttcggaaaatattcaattgaaacttggtat
tcgtcaccttacccacaagaatatgctaggttaccaaagctgttcctgtgcgagttttgt
ttaaaatacatgaaatcccacaccatacttcagcgacacgctcgtaaatgtccgtggttc
cacccacctgccaatgagatttatcgctcaaataatttgtcaatctttgaggtggatggg
aatgtcagtaagatctattgtcaaaacctttgcctgcttgccaagttgtttcttgaccac
aagacattatattacgatgtggaacctttttcattctactgcctaaccattaatgattca
aagggctgtcatttggttggttacttttcaaaggaaaagcattgtcagcagaagtataac
gtgtcttgtataatgaccatgccacaataccaacggcagggctatgggaggttccttatt
gatttcagttatttgctttctcgcaaagaaggtcaagccggttcaccggagaaaccactg
tctgatctgggtgaggtttcttacaatgcctactggaggtcaacattactcgactatttc
tcaaaacaactcaatgaaaaaaatatttctcttcgagacatcagcaagagcacaggtata
tgtccgcatgacattgcgatggtgttgcaaaagttgggtatgatcagtgtaacaccgggt
ggcgctagtgaggaagaagttgttgatgcaatcaaattcaatctgaaaagacggagaaag
atggtgatggaatatatcaagaagaagcaacagagggataacgattcaacgagaccccca
agacccacagttgattcggactgccttcgttggacccctcttatttcaagtaatagctgg
ggctcggatgagtcagttctgaagtcgccttctacaactccagaaaagatcaggccatca
accgagcaaaaaacatcgattaacggaacatctcatgtggctgaggagcatattgaagct
acggaggatgctaatgtagatcctgaagcacaagaagatgctgaggaagatggagaacaa
catcctcatcaggaaaacaatacaacagagaatgtagcaaatgatgtagacttatgtgag
agcattgattattttgaagataaaaatgaacccgttgaacaacatgatgataaaatgagt
gatacaagttcttctaacgagaaatctggggcgaagcgtcgtggcagacctcggaaatca
tttccttccgattcagtgttcccgctcaccaaagatgtgtctgtgacatcacaatgcgat
gcaacatcattaagctcttctttctctcccctccggaagagaagaaagaggaaagttaag
ggatatccgtggggtaggattaagtcaagaaaaaagaaaaagaaaatttctgaaaaatct
tccgagaagacacaaagtgatgcagagccatcagctacagggagtggatggaggttggga
ggtcctcatctatcctccgagtcggagactgaaattaatgatgcagatgaacgagaatct
gaggcaaactcggcacgagctgcttctcatgatgatacgttgagtttcgaaaccacaagt
gcttctggtgcaagcaaagatacggaaagtgacgacgaaacatttgttcccattgtggca
aaaggtcggattctgccgaggaaaaaaggccgtcgacgaaaatctaaaggctaccagtgg
ggggcaataaggaggaagattaaaaaacctgtctgccagaaattaggcaacggatctccg
gtcaagtctccaaagcgtcctggtaggccgcgtaaaatgctgctgtcacctaaagagaga
gagaatacaccaccccagccatctaagtcaccaacacctgcttctccagttaaatccacc
aaacaaactaccatggatagattttttcggcggaaatgtgaaccgaaagtagctgaaggt
aaagaatccctgaaacagcttaactgcaatggaaacaacgtgaagcagcaagattctgaa
accaagtccacaaacttatacgatgcattaaaagattctacccatgtggttgtagcaagc
gtgacagtctcaccagccaaaagactccgtagtccttcattttcacaaccaacgttaagt
tcattgaaacagcaagaatatgagtcaccggagccaaaacgaagacgacgcagcgcaatt
gccggcgaaaattttgtagcaagctgtattctgtcttctcgctctccccgacgtccacat
gagaggtcctccaaagataactcgagttctgatgaagatgcaggacctcaagaagaagag
tccaaatgtactgacacccagttaaaccagggctttcctgttctgggtgagaataaagtg
ttaaacagaacttttttaggattatgcccccaggaccaaagtaacagtctactcaaccca
ctaaacaaatctgaaaaccaggtttcgaccgtcgcattcgctaagccatggatctccacg
ttgagctcaggcacagcaaacacggcgcagtctcaacgcagctcgttctctcttcccaat
gagggaggattcaacatgatgtcttttcgttccgctaacatccagcaccaacagaagaaa
tcctccggttctaaagtgacacttcgtccttcgtcactgaccgtgtaccgtgacatgacc
cggagcaacttggatgaagataatgatccaagttcatcatcttcttccgatgctgactca
tcatgttcatcatctgctgagtcatcgtcatccgatgttgaagcggattttgtcgccacg
gagaatttcgatctgcagtggcgaggtcaggagaaagcgaagaaactttcgaaacgaaaa
tcaaacacacaaaaatgtcacaaacttaaatcacatcaattacttgactcaaattctaca
gatgacgttgcaacaagtgatcaggtgaaggaaaaagacaccacagaaatgaaagactat
ggcctgggggcaacaaatagggggggaggggaagaaaaaaaggttgggatggtgaagcgg
ggtagggggaggcccagaaagaaccctgttgcaccactcaaccctgaaaaattggctgaa
aagccaaagctgaagaagagagggagaaaaccaaaacaggagaaagatcttccgtcgaaa
ggtggaatcaagttgacggtgatgaggacggaagacgggtatcatacgaccaattctgtc
tctgggagctcctctgaaaagatcacggaaggtcctcaaatagatgaggatgaccttgtg
gacctaaaagaagtgaaagagattgaagaggagcagaggataaaagatgaatctgaaccg
gatggtttagtaaagaagatgggatctccggggcaagatgactcgaaatcttggtgtgat
tacgaatccaccggtggcagtgcagggtcagacagcgaggtgacaacagaaaaggaagag
aaattactcaagcgaaacggagacccaacgttacctaaatgggatcccaactcaacaaaa
ggtaaccctgattcctgggatataaacccggagtcacctgccaaggaatcctcattcagt
gactcccaaccaacctcaatagctgatgttattgatgaaagtagtcttggcacagttttc
ccagctgttgatgaaattcgtccttcctctgcacttgctgctgagattgccatgagagcg
gaaaatgaacaaaaagcagcgactggctttattgaagcaactaacgataatatggtggat
aacgatgcactaccagatgttaaaaatgatagaatcattccttttcaaatggatcgcaac
atatcgactaccaaggaagaacaacgagaaatatcagcagctgttgcttcaattattcca
gataatcaagattcaccaatcgatctggaatatagcgaggttttggaaaactatgaacaa
tcttccactgatgttgggaatgaaggggagactaagattgaagaagaagaggaagagagt
gaagtagtcatggaaaataaggaaaatgaatcttccagctctgatataactcttaacaca
acattagttgccgatataggtgaagatttaaatcaaaatgttccgtcaagttttccccaa
gattcaaacattacatcatccataccaactaatttcactgactgcaatttctcaaaaaaa
tctttagaaacttttgatatccaatcaaatacaagtaaacaactcactacggaagggcag
tcctacacagacattgagcaagatattaactcaaactcccagtacaagacctgtaacaat
acagatgtgtcaacaccattactccagcaatgtcggtacaaccaggaatataacgcacca
atttctgcacatgatacaacaacattccaatccacaaatacaggaacacagtttcagagc
aacagttcgtacacaaactcgtacccacaacagcagatgtaccacgacaacatgcagtat
cagaatagttacaccaacaatagagtggcaatatatgatacatcatgtacattgaataag
ggggcaaggcaagaacaaccaatgcagatggatcagccacacatggtgggtcaaacgcaa
aagggaaattaccagggtgtgattccctgtccctccacccgtcttgagtacacccatact
ggcgtagacgtggggcagatgccagccccttgtccccccggtgcggtccagggaccaagc
aaccacacacatggacacgttttccctaatggtgccgctggtgcagactttggctcgtcg
agtggatatgagactctcagcaataatagctgtagcccatatacgtcaccagacagcata
ccaagtatcaaccctagcagttgcgaccactcgggacagtctatggttccaaaccagcac
cctgacccaacgtactcatccccgcagtccagcgtttccgtggttggtatgggacaaagt
acgactgctgcaccaccaattatatactcggcaccaagcaacgactcaggtcacggtagc
gagtacctcgcatctcccaccaaccacggtttattatcatgccaaggaactccaccgaag
ccacccagcggtacagtacttagcccggatccgtattacgtgaacaagaagcaatcaact
tcaccgaatcgtcccagctgcgcagtgacgagcagcgcaggtttcgcgcatgtcaaccag
cggatgtcgccatgcgcacaacccgcatgtaacagttacgacgaatcacgaacacaagat
cgcacgaaagatctaaccagggcaaacagtctcttagagctgcagaaactgacacataag
gtatcttgccaacccaacaagacaccaacgtacccgaccggctccccggcgtttcagaaa
ccagacaattatgatttaaatcaaaaaatgccgcaatactctaccggtgaccgacccgcc
agcgtacagtctgtgccgggtgaaatgtgccagccgcataccacagttacaactccttca
catcctgcagataactcaaccacacaagcgacttaccacgggcataggcctgaacaaaag
cagcatgggagttacaaaaacgaagcatcataccacccgggttacagagcaggtcctgaa
cacgtacccggtcacccgtggccgccgcactcacaaatttggccgcgacagccaggcgga
tacggcccattcacccaccatgctcccacttacgagcagtggcacgggggcttcgggggt
taccctagctacccttcacaaggcgcttcatgtcagtttgagtcccagtatcgtctcaac
cctaacccgacgaacgatctagcggccgggtcgtcgggtagttaccacacttcgaacaaa
ttgaccccgaaccctttactggttccgcgcttaccgggccagccctacccacgagaacca
gagtcctatcaacgacctccagtcggttacgacccgctggcctcacgaaatggggttttt
aatcccaatgacacttctaaccgacgtataggctatcataaccaaccttacaatgcctat
cctcaaaaccctggaacctactataacccgtacatgtacgggtaa

DBGET integrated database retrieval system