KEGG   Ciona intestinalis (sea squirt): 100186811Help
Entry
100186811         CDS       T01056                                 

Definition
baculoviral IAP repeat-containing protein 7-B-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100186811
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    100186811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 479 aa AA seqDB search
MEPKDTWSMQQTPHMPTKQVPALVSYWVCSMQFETLKYNNRSGNNAPMQTAKYVEPVKSA
TSYQRIELATIASPYHEQLVRSLDLRKESDRSKTYENWPAQNRTVYASDLARSGFFYLGN
LDRVQCFSCGGVLRNWNYGDNITAEHTRHFPHCRMVQGTETRNVASPAQPNPQTTRTSTQ
EPPDPTESEKLELSEMFPCQYPVNPHMRNQDMRLATFDQRWQQRALQAKPAQISKAGFFF
LGDRDRVKCWYCNGGLQNWDPNDEPWTEHAKWFPTCEFLIRSKGPDFVHAMVSKYPNLPR
PILRGPFDVPPSIRRNSESTAPPPIMDHKKEMAEMKTKVKKHMESEEAKSVLEMGFGRKE
LEKVIKKKLKKDGKMFKSVVSIIDAMNDGTDSSDDEMEADEPQTQTPMSISDLDLSPSML
ARVAELEEERKCKVCLDKMADIVFIPCGHLCTCIECASALNKCPICRKRIEKSIRTYLN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaaccaaaagatacatggagcatgcagcagaccccacacatgccaaccaaacaagta
ccagcattggtgagttactgggtttgtagtatgcagtttgaaactttgaaatacaataat
cgcagtggcaacaatgcaccaatgcaaactgctaaatatgtggagcctgttaaaagtgca
acatcatatcagagaatagagctggcaacaatagcttcgccctatcatgaacaactcgta
agatcacttgatttgaggaaagaaagtgacagaagtaaaacgtatgagaactggcctgcg
cagaatcgaacagtatacgcaagtgatttggctcgttccggctttttttacctcggtaat
ttggatcgagtccagtgtttctcatgtggaggagtgttgcgcaactggaattatggggat
aatattacagctgaacacacgagacacttccctcattgcagaatggtgcaaggcacagaa
acaaggaacgtagcttcacctgcacaacccaacccacaaacaacgagaacatcaacccag
gaacctcctgatccaactgaaagcgagaagttggaactgagtgaaatgttcccatgccag
tacccggtgaatccccatatgcggaaccaagatatgagacttgcaacttttgaccagcgg
tggcagcaaagagcattacaagcaaaaccagctcaaatatcaaaagcgggatttttcttc
ttgggtgaccgagatcgtgtaaagtgctggtattgtaacggaggtttacagaactgggat
cctaatgatgaaccatggactgaacacgcaaagtggtttccaacatgtgaattcctaatt
cgtagcaaaggaccagactttgttcacgctatggtttcaaaatatcccaacctcccacga
ccgatattacgtggtccatttgatgttccaccaagcataagaagaaacagtgaaagtacg
gcaccaccaccaataatggaccataagaaagagatggctgaaatgaaaaccaaggtcaag
aaacacatggaaagtgaagaagctaagtcagtgttggagatggggtttggaaggaaggaa
ctcgaaaaagttatcaagaaaaaactaaaaaaagatggtaaaatgttcaaatcagttgtt
agcattattgatgcaatgaatgacggcacagattcatctgatgatgaaatggaagcggat
gaaccacaaacacaaactccaatgtctataagtgacttagatttatcgccttctatgctg
gcaagggtggctgagttggaagaagaaagaaaatgtaaagtttgtttagacaagatggcc
gacattgtatttataccgtgtggtcacctatgcacatgtattgaatgtgcatcagcattg
aataaatgcccaatttgtagaaaaaggattgaaaaatcaatcagaacgtatttaaattaa

DBGET integrated database retrieval system