KEGG   Ciona intestinalis (sea squirt): 100186834Help
Entry
100186834         CDS       T01056                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 2
  KO
K11833  
ubiquitin carboxyl-terminal hydrolase 2 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100186834
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100186834
Ubiquitin system [BR:cin04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100186834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 543 aa AA seqDB search
MTGYATHPRSSKVYGAQANYIRKPRSDFDTLPSRYTSTSSRLELSNIGSGSRNLIGDRPN
DSTYSYNSYLSNSNDLVRPATRHRGSSLRVSSGYNSDTDYKYSSSESRRRTKRISYTSNF
NLSSSSREKHLPNTMVATDTSSCSTPLKSDHSQSLRLEKKDLVTMDGQPYKEPYVPSFSG
SPKRSTPSPSRSLGKESGGNVGLRNIGNTCFMNSILQCLSNTTILREYCMDETYKGEINR
NSPMKGDLMRAFVEVLVRLWKPNGISHSPNNFKSKIQKFSPRFMGYEQQDCQEFLRFLLE
GLHEDINRVRIKSKEPLRELSHLSPQEKARATWSWYTTKDDSFIFDLFVGQLESSLECQE
CRHTSLTYDPFWDLSLPISKKMYSNEVTTITDCLDNFTREETLDKDEKPICERCKVRRTM
TKKLSIHKFPKVLVLHLKRFNEGSRYRQKLNNLVKFPVTSLNLRNFASKTREGNLPPTYD
LYAVSNHCGSCYGGHYTAYCYNSSSHAWLEYNDSSVNPISDGDVCTKEAYVLFYVRKEGS
SRL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttacgctacacatccacgcagtagtaaagtctacggagcacaagcaaactac
atacgaaaaccaaggtccgattttgacactttgccaagtagatatacctccactagttca
aggttggaactttcaaacattggaagtggatccagaaacctcattggtgatagacctaat
gattcaacttatagttataacagctatttatcaaattccaacgatttggtgagaccagca
accagacatagaggttcgagtcttcgtgtgtcttctggttacaacagcgacactgattac
aaatattcatcatcagaatcacgtcgaagaaccaaaaggatttcttacacttccaacttt
aatttaagttcatcttctagagagaaacatctaccaaacaccatggttgctaccgataca
tcttcatgttctacccccttgaagagtgatcactcgcaaagtttaaggcttgaaaaaaaa
gacctagtaacaatggatggtcagccatacaaagaaccatatgtcccctcttttagtgga
agtccaaagagaagcacaccatcaccgagtcgttcattggggaaagaaagtggtgggaat
gttggtttaaggaatattggaaatacgtgtttcatgaattcaattctccaatgtttatct
aacaccaccatactacgtgaatactgcatggacgaaacatacaaaggtgaaattaatagg
aattctccaatgaaaggcgatcttatgagagcctttgttgaagttttggttcgtctgtgg
aaaccaaatggaatctcacacagccccaacaatttcaagtcgaaaattcaaaaattttca
ccacggtttatgggatacgagcaacaagattgtcaggagtttcttcgctttttattggag
ggattgcatgaagatataaaccgtgtacgcatcaaatctaaagaaccgttgcgtgaactg
tcacatttaagtccccaggaaaaagctcgtgcgacttggtcatggtatacaaccaaagac
gacagttttatattcgatttattcgttggccagcttgaatcgtcattagaatgccaagaa
tgccgccatacgtcactcacttatgacccgttctgggacctttcgctgcccatatctaag
aaaatgtattccaacgaagtgaccacaattactgattgtttggacaactttactagggaa
gaaactttggataaagacgaaaaaccgatttgcgaaagatgcaaagttcgtaggaccatg
acaaagaaactttcaatacacaagtttcccaaagttcttgtcttacatttgaaacgtttc
aacgaaggaagcaggtatcgacagaagttgaacaatttggtcaagtttccagtgacgtca
ctcaacttacgaaatttcgcttcgaaaactcgcgaaggtaacttgccgcccacttatgat
ctatatgctgtatctaatcactgtggatcatgctacggtggacattacacagcgtattgc
tacaactcatcatcacatgcttggttagaatacaatgattccagtgtgaatcctatcagt
gatggtgacgtgtgcacaaaagaagcttatgtgttgttctatgtgcggaaagaaggaagc
tctcgtctctag

DBGET integrated database retrieval system