KEGG   Ciona intestinalis (sea squirt): 100186995Help
Entry
100186995         CDS       T01056                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:cin01200]
Metabolism; Overview; Fatty acid metabolism [PATH:cin01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:cin00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cin00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:cin00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:cin00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:cin00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:cin00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:cin00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cin00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 291 aa AA seqDB search
MAGYLAKASTNLLRKNISTYTALLRFSSSDTKQYENIIVEKRAENGCVGLIQLNRPKALN
SLCDALMREVNEALDTFEQDESVGCVVLTGNERAFAAGADIKEMQNNTFVGCLKGNFLGH
WSEIAQKKKPIIAAVNGFALGGGCELAMMCDIIYAGDNAQFGQPEILLGTIPGAGGTQRL
PKFVGKSLAMEMVLTGNRFDAQTALTAGLVSKVVSKELLVDEAIKTAEKISKNSQLVVAL
AKEAVNIAYETTLAEGLHFEKKLFHATFATEDRKEGMTAFVEKRKANFTNN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccggatatttggcaaaagcatctactaatttgttgaggaaaaacatttccacttat
actgcattgcttcggttctcttcatcagataccaaacaatatgagaacatcattgtggag
aagagggcagagaatggatgtgttgggttaattcagttgaatcgaccaaaagctcttaac
tcattgtgtgatgcacttatgcgtgaagtaaacgaagcattagatacatttgaacaagat
gaaagtgtggggtgcgtagttctaactggaaatgaaagagcttttgcagctggtgcagac
attaaggagatgcagaacaacacatttgttggatgtcttaagggaaactttcttggacac
tggtctgaaatcgcacaaaagaaaaaaccgatcattgcagctgtgaatggatttgctctt
ggtggaggttgtgagttagcaatgatgtgtgatattatttatgccggggataatgcacaa
tttggtcaaccagaaattttactaggaaccataccaggtgctggtggtactcaacgatta
ccaaagtttgttggcaaatcactggcaatggaaatggtgttgactggaaataggtttgat
gcccaaactgcactcacagctggtttggtgagcaaagttgtaagcaaggaacttcttgtt
gatgaagcaataaagactgcagaaaaaatttcaaaaaattcacaattggttgttgcactt
gcaaaggaagctgttaatattgcttatgagacaacgttagccgaaggtctacactttgaa
aagaaactattccatgcaacgtttgcaacggaggatagaaaagaaggcatgactgccttt
gtggagaaaagaaaggcaaattttacaaataattag

DBGET integrated database retrieval system