KEGG   Ciona intestinalis (sea squirt): 100186995Help
Entry
100186995         CDS       T01056                                 

Definition
enoyl-CoA hydratase, mitochondrial-like
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100186995
   01212 Fatty acid metabolism
    100186995
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100186995
   00650 Butanoate metabolism
    100186995
  Lipid metabolism
   00062 Fatty acid elongation
    100186995
   00071 Fatty acid degradation
    100186995
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100186995
   00310 Lysine degradation
    100186995
   00380 Tryptophan metabolism
    100186995
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100186995
Enzymes [BR:cin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100186995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
3
AA seq 291 aa AA seqDB search
MAGYLAKASTNLLRKNISTYTALLRFSSSDTKQYENIIVEKRAENGCVGLIQLNRPKALN
SLCDALMREVNEALDTFEQDESVGCVVLTGNERAFAAGADIKEMQNNTFVGCLKGNFLGH
WSEIAQKKKPIIAAVNGFALGGGCELAMMCDIIYAGDNAQFGQPEILLGTIPGAGGTQRL
PKFVGKSLAMEMVLTGNRFDAQTALTAGLVSKVVSKELLVDEAIKTAEKISKNSQLVVAL
AKEAVNIAYETTLAEGLHFEKKLFHATFATEDRKEGMTAFVEKRKANFTNN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccggatatttggcaaaagcatctactaatttgttgaggaaaaacatttccacttat
actgcattgcttcggttctcttcatcagataccaaacaatatgagaacatcattgtggag
aagagggcagagaatggatgtgttgggttaattcagttgaatcgaccaaaagctcttaac
tcattgtgtgatgcacttatgcgtgaagtaaacgaagcattagatacatttgaacaagat
gaaagtgtggggtgcgtagttctaactggaaatgaaagagcttttgcagctggtgcagac
attaaggagatgcagaacaacacatttgttggatgtcttaagggaaactttcttggacac
tggtctgaaatcgcacaaaagaaaaaaccgatcattgcagctgtgaatggatttgctctt
ggtggaggttgtgagttagcaatgatgtgtgatattatttatgccggggataatgcacaa
tttggtcaaccagaaattttactaggaaccataccaggtgctggtggtactcaacgatta
ccaaagtttgttggcaaatcactggcaatggaaatggtgttgactggaaataggtttgat
gcccaaactgcactcacagctggtttggtgagcaaagttgtaagcaaggaacttcttgtt
gatgaagcaataaagactgcagaaaaaatttcaaaaaattcacaattggttgttgcactt
gcaaaggaagctgttaatattgcttatgagacaacgttagccgaaggtctacactttgaa
aagaaactattccatgcaacgtttgcaacggaggatagaaaagaaggcatgactgccttt
gtggagaaaagaaaggcaaattttacaaataattag

  All links  
No link information was found.   
DBGET integrated database retrieval system