KEGG   Ciona intestinalis (sea squirt): 100186995Help
Entry
100186995         CDS       T01056                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00062  Fatty acid elongation
cin00071  Fatty acid degradation
cin00280  Valine, leucine and isoleucine degradation
cin00310  Lysine degradation
cin00380  Tryptophan metabolism
cin00410  beta-Alanine metabolism
cin00640  Propanoate metabolism
cin00650  Butanoate metabolism
cin01100  Metabolic pathways
cin01200  Carbon metabolism
cin01212  Fatty acid metabolism
Module
cin_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
cin_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100186995
   00650 Butanoate metabolism
    100186995
  Lipid metabolism
   00062 Fatty acid elongation
    100186995
   00071 Fatty acid degradation
    100186995
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100186995
   00310 Lysine degradation
    100186995
   00380 Tryptophan metabolism
    100186995
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100186995
Enzymes [BR:cin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100186995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 Phage_holin_6_1
Motif
Other DBs
NCBI-GeneID: 100186995
NCBI-ProteinID: XP_002125020
Ensembl: ENSCING00000005478
UniProt: F6WAG8
Position
3
AA seq 291 aa AA seqDB search
MAGYLAKASTNLLRKNISTYTALLRFSSSDTKQYENIIVEKRAENGCVGLIQLNRPKALN
SLCDALMREVNEALDTFEQDESVGCVVLTGNERAFAAGADIKEMQNNTFVGCLKGNFLGH
WSEIAQKKKPIIAAVNGFALGGGCELAMMCDIIYAGDNAQFGQPEILLGTIPGAGGTQRL
PKFVGKSLAMEMVLTGNRFDAQTALTAGLVSKVVSKELLVDEAIKTAEKISKNSQLVVAL
AKEAVNIAYETTLAEGLHFEKKLFHATFATEDRKEGMTAFVEKRKANFTNN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccggatatttggcaaaagcatctactaatttgttgaggaaaaacatttccacttat
actgcattgcttcggttctcttcatcagataccaaacaatatgagaacatcattgtggag
aagagggcagagaatggatgtgttgggttaattcagttgaatcgaccaaaagctcttaac
tcattgtgtgatgcacttatgcgtgaagtaaacgaagcattagatacatttgaacaagat
gaaagtgtggggtgcgtagttctaactggaaatgaaagagcttttgcagctggtgcagac
attaaggagatgcagaacaacacatttgttggatgtcttaagggaaactttcttggacac
tggtctgaaatcgcacaaaagaaaaaaccgatcattgcagctgtgaatggatttgctctt
ggtggaggttgtgagttagcaatgatgtgtgatattatttatgccggggataatgcacaa
tttggtcaaccagaaattttactaggaaccataccaggtgctggtggtactcaacgatta
ccaaagtttgttggcaaatcactggcaatggaaatggtgttgactggaaataggtttgat
gcccaaactgcactcacagctggtttggtgagcaaagttgtaagcaaggaacttcttgtt
gatgaagcaataaagactgcagaaaaaatttcaaaaaattcacaattggttgttgcactt
gcaaaggaagctgttaatattgcttatgagacaacgttagccgaaggtctacactttgaa
aagaaactattccatgcaacgtttgcaacggaggatagaaaagaaggcatgactgccttt
gtggagaaaagaaaggcaaattttacaaataattag

DBGET integrated database retrieval system