KEGG   Ciona intestinalis (sea squirt): 100187173Help
Entry
100187173         CDS       T01056                                 

Definition
cytochrome P450 3A25-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    100187173
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100187173
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100187173
Cytochrome P450 [BR:cin00199]
 Cytochrome P450, animal type
  CYP3 family
   100187173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 512 aa AA seqDB search
MYIPSFLSVETLVLLITSLVLVRIYIHKKWQFLKNINIPHIQPTILQLGTVRPFIGNSDW
MMNSHEYCKRKLGKIYGAYLFLTPQITVADPDIIKQMYIKEFATFPTRQTSLTKINGKVM
NTTILMTEGEQWKRIRNTLTPSFSTAKLKEMLGIMEDCCNHAINILIKTTQNDQGKFEAK
SVFGKLALDITCSAAFSVDTHPQELKDGQEPKIIKMVKQAFGFEISRSPLVMLCFMFPAF
EEILCKLDYSIIPKDTVNYFANLTKSLIDQRKHSTVKPRVDLMQLMLNDQISVEDVAKGK
SKGLTQLEITSNSVLMVLAGYDTSANALTLLAYNLATHKHVQKKVQEEIDKMLEKYGSLT
YEALNSMKYLGMCLNETLRLYPPIAVNSRIPNRDITINGVFLPKGIQVIVPVYGMSRDEE
IWEEPLKFKPERMEDMRSVDSMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVC
ENTPKPPVQLEFKSTTLKPKGDIYLRVTPKSN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtacataccaagttttctgtccgttgaaactttggttttattaataacatctcttgtg
ttggttcgaatctacatacacaaaaaatggcagtttttaaagaatatcaatatcccacat
attcaacctacaattctacaacttggaactgttcggccatttattggtaattcagactgg
atgatgaacagtcatgaatattgtaaaaggaaacttggtaagatctatggtgcatacctt
tttctgaccccacaaataactgtggcagatccagacatcataaagcaaatgtatatcaag
gagtttgcaacttttcccactcgccagaccagtttgacaaaaattaatggaaaggtgatg
aacaccactattctgatgacggaaggagagcaatggaaaagaattagaaacacgcttact
cctagtttttcaaccgcaaagttgaaagaaatgttgggcataatggaagactgttgtaat
catgcaattaatattcttattaaaactacacagaatgaccagggtaagtttgaagcaaaa
tccgtgtttggaaaacttgctcttgatataacctgctctgcagcatttagtgttgacact
catcctcaagaattaaaagatggccaagaaccaaaaatcataaaaatggtgaaacaagca
tttggttttgaaataagtcgcagcccattagttatgctttgtttcatgtttcctgcattt
gaggaaattctgtgcaaacttgactacagtataattccaaaggatacagttaattatttt
gctaatcttacaaaatcactgattgatcaaaggaagcattcaacagtaaaacctcgtgtt
gatttgatgcagcttatgcttaatgaccaaatatctgttgaggatgtggccaaaggtaaa
tccaaaggtttgacccagttagaaataaccagcaacagtgttctcatggtattagctggg
tacgacacctcagcaaatgcattaacactacttgcttacaaccttgctacccacaaacat
gttcaaaaaaaagttcaggaagagattgataaaatgctagaaaagtatggctctttaacg
tatgaagctcttaacagcatgaaataccttggaatgtgcctaaacgagacattaaggctt
taccctcctattgctgtaaactctcgaatcccaaaccgtgacatcactattaatggagtc
tttttaccaaaaggtatccaagttattgtcccagtttatggcatgagcagagatgaggag
atatgggaggaaccactcaaattcaaaccagagaggatggaagacatgagatcagttgat
tccatgatttttcaaccatttggtggaggaccacgtggctgtattggaatgagatttgcc
gtgttggaaattaagcttgcaattgcaaaaattcttcaggactttaaccttgatgtatgt
gaaaatacccctaagccccctgtacagttagaatttaaatccacaacactgaagccaaaa
ggggatatttacttgcgagtaactcccaaatcaaactag

DBGET integrated database retrieval system