KEGG   Ciona intestinalis (sea squirt): 100187173Help
Entry
100187173         CDS       T01056                                 

Definition
cytochrome P450 3A25-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:cin00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cin00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 512 aa AA seqDB search
MYIPSFLSVETLVLLITSLVLVRIYIHKKWQFLKNINIPHIQPTILQLGTVRPFIGNSDW
MMNSHEYCKRKLGKIYGAYLFLTPQITVADPDIIKQMYIKEFATFPTRQTSLTKINGKVM
NTTILMTEGEQWKRIRNTLTPSFSTAKLKEMLGIMEDCCNHAINILIKTTQNDQGKFEAK
SVFGKLALDITCSAAFSVDTHPQELKDGQEPKIIKMVKQAFGFEISRSPLVMLCFMFPAF
EEILCKLDYSIIPKDTVNYFANLTKSLIDQRKHSTVKPRVDLMQLMLNDQISVEDVAKGK
SKGLTQLEITSNSVLMVLAGYDTSANALTLLAYNLATHKHVQKKVQEEIDKMLEKYGSLT
YEALNSMKYLGMCLNETLRLYPPIAVNSRIPNRDITINGVFLPKGIQVIVPVYGMSRDEE
IWEEPLKFKPERMEDMRSVDSMIFQPFGGGPRGCIGMRFAVLEIKLAIAKILQDFNLDVC
ENTPKPPVQLEFKSTTLKPKGDIYLRVTPKSN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtacataccaagttttctgtccgttgaaactttggttttattaataacatctcttgtg
ttggttcgaatctacatacacaaaaaatggcagtttttaaagaatatcaatatcccacat
attcaacctacaattctacaacttggaactgttcggccatttattggtaattcagactgg
atgatgaacagtcatgaatattgtaaaaggaaacttggtaagatctatggtgcatacctt
tttctgaccccacaaataactgtggcagatccagacatcataaagcaaatgtatatcaag
gagtttgcaacttttcccactcgccagaccagtttgacaaaaattaatggaaaggtgatg
aacaccactattctgatgacggaaggagagcaatggaaaagaattagaaacacgcttact
cctagtttttcaaccgcaaagttgaaagaaatgttgggcataatggaagactgttgtaat
catgcaattaatattcttattaaaactacacagaatgaccagggtaagtttgaagcaaaa
tccgtgtttggaaaacttgctcttgatataacctgctctgcagcatttagtgttgacact
catcctcaagaattaaaagatggccaagaaccaaaaatcataaaaatggtgaaacaagca
tttggttttgaaataagtcgcagcccattagttatgctttgtttcatgtttcctgcattt
gaggaaattctgtgcaaacttgactacagtataattccaaaggatacagttaattatttt
gctaatcttacaaaatcactgattgatcaaaggaagcattcaacagtaaaacctcgtgtt
gatttgatgcagcttatgcttaatgaccaaatatctgttgaggatgtggccaaaggtaaa
tccaaaggtttgacccagttagaaataaccagcaacagtgttctcatggtattagctggg
tacgacacctcagcaaatgcattaacactacttgcttacaaccttgctacccacaaacat
gttcaaaaaaaagttcaggaagagattgataaaatgctagaaaagtatggctctttaacg
tatgaagctcttaacagcatgaaataccttggaatgtgcctaaacgagacattaaggctt
taccctcctattgctgtaaactctcgaatcccaaaccgtgacatcactattaatggagtc
tttttaccaaaaggtatccaagttattgtcccagtttatggcatgagcagagatgaggag
atatgggaggaaccactcaaattcaaaccagagaggatggaagacatgagatcagttgat
tccatgatttttcaaccatttggtggaggaccacgtggctgtattggaatgagatttgcc
gtgttggaaattaagcttgcaattgcaaaaattcttcaggactttaaccttgatgtatgt
gaaaatacccctaagccccctgtacagttagaatttaaatccacaacactgaagccaaaa
ggggatatttacttgcgagtaactcccaaatcaaactag

DBGET integrated database retrieval system