KEGG   Ciona intestinalis (sea squirt): 100187208Help
Entry
100187208         CDS       T01056                                 

Definition
OTU domain-containing protein 5-A-like
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 592 aa AA seqDB search
MTILPKKKVTKDKIQNDKTQGSHEHLSTQHHSQHSESVSSRARHETSQIRSTAHSSGQLD
DRQHRTRPRHPPEFQVLASTENQASPLGPAYDTSVVDGATGVACGLVDPALQLHARVTQA
SSDISDVPPVVLNVPVPGESSVIERPAVVKRRHGRQSPHSIPYSRTGKNSRGSPTTPDNA
GSSGMLAPASKHHGAMRRHHSVQDDRRPISPPVNVGLGNAARSTRRRQRSRAEGKEDKVE
HNSDDEYDAARLRRLHQGVNFEELETKFAQALKEVRGFVIKETVEDGACLFRAVAEQVYG
DQNMHDEVRRNCMDYMTKNSDFFSHYVTEDFVAYVTRKRLPHTHGNHLEMQAMAEMYNRN
IHVYQYSTEPINTFQSSNITGNEPIRVSYHRNSHYNSVINPYKASVGVGLGLPSFHPGLA
DRKLLDSAQRASEQELLERQMLEDKFLATDWENTEDEMVREVAHSSLVQYLQHQEAMARA
KKNTTDNSTEATEPTCSQEATSSQSATASALPNTEMAIKESNAAEDSSLAPSTSQASFPI
FSNTGYSDWVDQSDESAVLAQVMAQSQREYYEALTKPGTSSTATCSKYPTYH
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgactattctgcccaaaaagaaggttactaaagataaaatacaaaatgataagacacaa
ggcagccatgagcacctatcaacacaacatcattcacaacacagcgaaagtgtaagcagt
cgtgcccgccatgaaacttcacaaattcgatctacagcgcactcaagtggccagttggat
gacagacaacatagaacgagaccacgtcatccacctgaatttcaagtgctggcaagtact
gaaaaccaagcctctccccttggcccagcatatgacacttctgtggttgatggagccact
ggtgtagcatgtggattagtcgaccctgctttgcaattgcatgcgcgagtaacacaagca
agcagtgacatttcagatgtaccaccggtcgtactaaatgtcccagttccaggcgaatcc
agtgttatagaaagacctgcggtggtaaaacgcagacacggtcgtcagtccccacattct
ataccatactctagaactggtaaaaattctcgcggctcccccaccacaccagataatgct
ggcagcagcggcatgctggcaccggcttctaaacaccacggagccatgaggagacaccac
agtgtacaggacgaccggcgaccgatttcaccgcctgtaaatgtgggactaggcaatgct
gcaagatctacacgacgtagacaaagatctcgtgctgaagggaaagaagacaaagtagaa
cataactctgatgacgagtatgatgctgcaagactaagaaggctgcatcaaggagtcaat
tttgaagagcttgagactaaatttgctcaagccctaaaagaagttcgaggtttcgttatc
aaggaaactgtagaggatggtgcttgcttgtttcgtgctgttgctgagcaagtgtatgga
gatcagaacatgcatgatgaagtcagaagaaactgcatggattacatgacgaagaattct
gatttcttttcccactacgtcactgaggattttgttgcatatgtaactcgtaagcgattg
ccccacacacatggcaaccaccttgagatgcaggcaatggctgaaatgtacaaccgaaat
atccatgtttatcagtacagcactgagccaatcaacacattccaatcatcaaatataact
ggtaatgagccgataagagttagctaccacagaaactcccattacaactcagtcatcaat
ccttacaaagcaagtgtgggagttggacttggactaccatcctttcaccctgggttggcg
gatcgtaaactgcttgacagtgcacagagggcatcggagcaagagctcttggagaggcag
atgttggaggacaagtttctcgctacggactgggagaacacggaggacgagatggttaga
gaggtcgctcactcttcgctcgtacaataccttcaacaccaggaggcgatggcaagagca
aaaaagaacactacggataattcaactgaggcaacagaaccaacttgttcacaagaagcc
acaagttcacagtctgccactgcttctgcacttcccaatacagaaatggctattaaagag
tcaaacgctgccgaagactctagtctcgcaccaagcacatcacaagccagcttcccaatc
ttcagtaatactggttactctgactgggtcgaccagtctgatgaaagtgcagtccttgca
caagttatggctcaatcacagcgtgaatattacgaagcgcttacgaagccaggtacctct
tctacagctacctgcagcaagtaccctacataccactaa

DBGET integrated database retrieval system