KEGG   Ciona intestinalis (sea squirt): 100187224Help
Entry
100187224         CDS       T01056                                 

Definition
proteasome assembly chaperone 1-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100187224
   00670 One carbon pool by folate
    100187224
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100187224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 391 aa AA seqDB search
MKIHTVSACCKNYGIGFKGSLPWSLPTEFAYFVRLSTGNPPPGKRNVVILGRKTWDSKPH
ARLNRINVVLSRSNKPVQDRNEKPDFVAHSLEEAVAMLESDEWKDKIHEVFAIGGHDIYK
LVHDSPYCGTVYLTRVDAEYESDTFYPKLDDSFELLPTDKPPVYKWKGEIKVTKFDNFVF
GFGAVATGFIESYCLTSDKLNEVGKLIEVIDSEATGTKAKEQCILRVYADGNTNKTMYCT
SKAYVASHKIWPLQQEIFFKFQIDQSASVVVLDSAPIHDFKTHDCDIITPVVRSLRTNGS
NKLNAFPMLERPNLVKGVSAAILTICELQDIQAELCVCYTATFEIDFASIQAFCPLLDTD
AFSTIEKNNPISIPRIKTLLANQGSTQSLYT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatacacacagttagtgcatgttgcaaaaactatgggattggatttaaaggatct
ttgccctggagtttaccgacagagtttgcatattttgttcgcttgagtaccggcaatcca
ccacctgggaaaagaaatgtcgtgattttaggccgcaaaacttgggattcaaaaccacat
gctcgtctaaaccggataaatgtagttttatctagatcaaacaagccagttcaggacaga
aatgaaaaaccggattttgtcgcccattcattagaagaagcagtagccatgttggaatct
gatgaatggaaagataaaatacatgaagtgtttgcaattggaggacatgatatatataag
ctggttcatgactccccatattgcggcactgtgtatcttacaagagtggatgctgaatat
gaaagcgacactttttaccccaaacttgacgacagttttgaacttttaccgacagacaag
cctcctgtttataaatggaaaggagaaataaaagtcaccaaatttgacaactttgtgttt
ggatttggggcagtagcaacagggtttattgaaagctattgtttaaccagcgacaagtta
aacgaagttggaaaacttattgaagtaattgattcagaagcaactggcacaaaagccaaa
gaacaatgcatactgagagtatatgctgatggtaatacaaacaagacaatgtactgtaca
agtaaagcttatgttgcctcccataagatatggcctttacaacaagagatatttttcaag
ttccaaattgaccaatcagcttcagttgttgttttggactcggctcctattcatgatttc
aaaactcatgattgtgacatcataacacctgttgttaggtcacttagaaccaatggttca
aataaattaaatgcatttccaatgttagaaagacctaatttggttaaaggtgtttctgct
gcaatattaacaatatgtgagctacaagacatacaagctgaactatgtgtatgttacact
gctacttttgaaattgattttgcatcaattcaagccttttgtccattacttgacacagat
gcattttccacaattgaaaagaacaacccaatctcaataccacggatcaaaacattgctg
gcaaaccaaggctctacccaaagcttgtatacttga

DBGET integrated database retrieval system