KEGG   Ciona intestinalis (sea squirt): 100187229Help
Entry
100187229         CDS       T01056                                 

Definition
non-lysosomal glucosylceramidase-like
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cin00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cin00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 861 aa AA seqDB search
MDCEPEWWKQLEDVSLNHPCDEDDNNLMQSWRGKSLGHNVPEHGWKIALSHKFKTKPTPW
SFPPLTQIPSVLGLAVRYLQYYNQLRRKNKKPCMDFFNQHPLRPIYGVPLGGIGSGTINR
GWQGDFCKWQLKPGIYTFDCPLADQFIVSIRRHNTVVCQQVLSTKGPSGEALRTWNWKYC
GSYAYYNGLYPRAWTVYDLQGQNIVLTCRQISPVFPNDYKDTSLPAAVFVWDVENRGNEE
VEVTIVMSLENGTGNPEQQKKVSGLWNEPFSNTDHNNKAKGVVMHNTTYRDMPYTLTVAA
AEKPGVDVTHCTSFNPTHNGAEVWNSLLNTGRLQSKPGKSSLTATGEHTACAVAASCKVK
PHSMAGSMDFALTWDMPQIHFGDAGKHYKRRYTRWFNGDNAGATIASYALDNYQTWEDKI
EAWQRPILDNKQLPDWYKSAIFNELYYITDGGTVWLEVAEEENGTANGKVPETLQNTTKV
DSCDFLKEYGKFAYLEGQEYKMYNTYDVHFYASIALAYLWPKLELSVQYDIATSILHSNP
QPHKYLMDGVTAPVKTPNVVPHDVGCPEDEPWLRVNTYFVHDTADWRDLNPKFVLQAYRD
YYITKDIDFLKAMWPICKIVMEQSMRHDKDNDGLIENSGAADQTFDGWCVTGPSAYCGGL
WLAALRCMEEAADILHEKDDQVKFHDILVRATKAYQDRLWNGKYFNYDCSNNPQHRTSVM
ADQCAGQWFLLASGICDVLPDDQVMSSLKTIFSLNVEQYDGGRHGAVNGMRPHGAVDTSS
VQSDEVWTGVTYALAATMIHKGMLKEGFRTASGIYRSCWQRYGMAFQTPEAMRKNHTYRS
LAYMRPLSIWGMQYALENPKE
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atggattgtgaaccagaatggtggaaacagttggaagatgtgagtttgaaccacccttgt
gatgaggacgataataatctaatgcaaagttggaggggtaaatcgcttggccacaatgtt
ccagaacatggatggaaaatagcgctgagtcataaattcaagaccaaaccaaccccatgg
tcgttcccacctttgactcagatcccatctgttttaggactcgctgtcaggtacttacag
tattacaaccagttaagaagaaagaacaaaaaaccttgcatggacttctttaaccaacac
ccattaagaccaatatatggtgtaccacttggaggcataggtagcgggaccatcaaccgt
gggtggcagggtgatttctgcaagtggcaacttaaaccaggaatatatacgtttgattgt
ccacttgctgatcagtttatagtttctataagaagacacaacacagtagtttgccaacaa
gtacttagtaccaagggaccatcaggagaggctttacgaacttggaattggaagtactgt
ggttcatacgcatactacaatggattataccctcgtgcatggacggtatatgatttacaa
gggcaaaacatcgttttaacttgtagacaaatatccccggtattccctaatgattacaag
gacacaagcctcccagcagcggtgttcgtctgggacgttgagaatcgcggaaacgaagag
gtggaagtaactattgtgatgtcactggagaacggaaccggcaaccctgaacaacaaaag
aaagtatcaggattatggaatgaaccgttcagtaatactgaccataataataaagcaaag
ggtgttgtgatgcataatacaacgtatagggatatgccgtacacattgactgtagctgct
gctgaaaagccaggtgtagatgtgacacactgcaccagcttcaatccaacccacaacgga
gctgaggtttggaactcgttgttgaatacaggaagattacaatctaaaccaggtaaaagt
tcgttaacagctacaggcgagcacacagcatgcgctgtagcagcttcatgtaaagttaaa
cctcactccatggctggctctatggactttgctttaacatgggatatgccacagattcac
tttggtgatgcaggcaaacactacaagcgtcgatacacgcgctggtttaatggggacaac
gctggtgctacaatcgcttcttatgctttggataattatcaaacatgggaggataagatt
gaggcgtggcaacgacctatacttgataacaaacagcttcctgattggtacaaatcggca
atcttcaatgagctttattacatcacagatggtgggactgtgtggttagaagtggctgag
gaggaaaatggaacagccaacggaaaagtaccggaaactttacagaatacaactaaagtt
gacagttgtgacttcttgaaagaatacggaaagtttgcttatttggaaggacaagaatat
aagatgtataacacatatgatgttcatttctacgcttctattgcccttgcttatctatgg
ccaaagctagagttaagtgttcaatatgatatagctaccagcatcctacattcgaaccca
caacctcataaatacttaatggatggggtgaccgctcccgttaaaacccccaacgtggtc
ccacatgatgttgggtgtccagaggacgaaccatggttaagagtgaacacatattttgtc
cacgacaccgccgactggcgcgacctcaacccaaagttcgtattacaagcatatcgggat
tattacatcactaaggatattgactttcttaaagctatgtggccgatatgcaagattgta
atggagcaaagcatgaggcacgataaagataacgatggattgattgaaaacagtggagca
gcggatcaaacttttgatggatggtgtgttactggaccaagtgcgtactgtggagggtta
tggcttgctgcgttacgttgtatggaggaagccgcagacattctgcatgagaaagatgat
caagtcaagttccatgatatattagtgagggctaccaaggcttatcaggaccgtttatgg
aacggtaaatatttcaactacgattgcagtaataacccccaacacagaacaagtgtaatg
gccgaccagtgtgcggggcagtggttcctactcgcttcagggatttgtgatgtcctcccc
gatgatcaagtgatgtcgtcattaaaaacaatattctcgctcaatgtggagcagtatgac
ggggggcgccatggtgccgttaacggaatgcgaccacacggggcagtagacacatctagt
gttcaatctgacgaagtatggacgggggtgacgtacgccctcgctgctactatgatacat
aagggcatgttgaaagaaggtttccgcacagcgagtggaatttacagatcatgttggcag
aggtatgggatggcgtttcagacaccagaagccatgaggaagaaccatacatatagatcc
cttgcttacatgcggcccttaagcatatggggcatgcaatatgcattggaaaacccaaag
gaatag

DBGET integrated database retrieval system