KEGG   Ciona intestinalis (sea squirt): 100187330Help
Entry
100187330         CDS       T01056                                 

Definition
(RefSeq) calcineurin subunit B type 1
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100187330
Protein phosphatases and associated proteins [BR:cin01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100187330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 100187330
NCBI-ProteinID: XP_002130765
Ensembl: ENSCING00000017913
UniProt: H2XZG7
Position
11
AA seq 170 aa AA seqDB search
MGNDLTMPMEMCSHFDPDEIARLGKRFRKLDLDNSGSLSIDEFMSLPELQQNPLVQRVIE
IFDQDGNGEVDFREFIEGVSQFSVKGDKSSKLKFAFRIYDIDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIIYADKDGDGKISYDEFAAVVSSLDVHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgatcttaccatgccgatggagatgtgttcacatttcgatcctgatgagata
gcaaggcttggcaaacggtttcgaaagttagatctcgacaactctggttcactgagtatt
gatgagttcatgtcactgcctgagttgcaacagaaccctctggttcaacgagttattgag
atatttgaccaagatgggaatggagaggttgactttagagagtttattgaaggagtctcc
cagttcagtgttaaaggagataaatcatcaaagcttaaatttgctttccgtatttatgac
atcgacaacgatggattcatctcaaacggagaattattccaagttcttaaaatgatggtg
gggaataaccttaaggacactcagctgcaacaaattgtcgataaaacgatcatttacgcc
gacaaagacggtgatgggaaaatatcttatgatgaatttgctgcagttgtctcctcactg
gatgttcataagaagatggtagttgatgtctga

DBGET integrated database retrieval system