KEGG   Ciona intestinalis (sea squirt): 100187330Help
Entry
100187330         CDS       T01056                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cin04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 170 aa AA seqDB search
MGNDLTMPMEMCSHFDPDEIARLGKRFRKLDLDNSGSLSIDEFMSLPELQQNPLVQRVIE
IFDQDGNGEVDFREFIEGVSQFSVKGDKSSKLKFAFRIYDIDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIIYADKDGDGKISYDEFAAVVSSLDVHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgatcttaccatgccgatggagatgtgttcacatttcgatcctgatgagata
gcaaggcttggcaaacggtttcgaaagttagatctcgacaactctggttcactgagtatt
gatgagttcatgtcactgcctgagttgcaacagaaccctctggttcaacgagttattgag
atatttgaccaagatgggaatggagaggttgactttagagagtttattgaaggagtctcc
cagttcagtgttaaaggagataaatcatcaaagcttaaatttgctttccgtatttatgac
atcgacaacgatggattcatctcaaacggagaattattccaagttcttaaaatgatggtg
gggaataaccttaaggacactcagctgcaacaaattgtcgataaaacgatcatttacgcc
gacaaagacggtgatgggaaaatatcttatgatgaatttgctgcagttgtctcctcactg
gatgttcataagaagatggtagttgatgtctga

DBGET integrated database retrieval system