KEGG   Ciona intestinalis (sea squirt): 100187369Help
Entry
100187369         CDS       T01056                                 

Definition
uncharacterized LOC100187369
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    100187369
  Replication and repair
   03420 Nucleotide excision repair
    100187369
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     100187369
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 792 aa AA seqDB search
MESGCEVTKYCSSKKINGNESACHEMEVSNGPKRLLHKQTVEVPSSDPCCSNHTCQCSCP
DDYVPPPDKDTLKPYEELDVEDKCCANWTIKCEACLLQNGSSVAVGESIQVDDGSGCVVD
KYCSSKKINGNESACYEMKVSNDPREKCQPKAEFESTVCGAYQHAVEVVYSRDTIDPEPC
CSEFECVCNNHTMLSKQCPKWFNYTCPDPRMIAQQTNIIDDKQCCPEFKCVCPQCPNVTE
CQRKSWSPKVIDDSTYPAECGCLSTECECNPEYCSIFFPQPQCNEPHYNRTVVNATYYEE
CCPRVECTCVQENCANITYEGPSSCSPFEDLIELNQPAIECCTKHTACRCKNESQLNELC
MSSNATIPAGFVYAPILNDSTMRPNCCHYVCDTCKAKDGSIKKRGETWVEDDSGCGVEYL
CTDKKEEYGDRCFIRNGTVEVPSSDPCCSNHTCQCSCPDDYVPPPDKDTLKPYEELDVED
KCCANWTIKCEACLLENGSSVAVGESIQVDDGSSEGGRSYSIITAKGFQFLLLDNASQVW
YFVLEYLDWVRERGMNLVPILRFIFELSFSSPGKDLPTDGRDDHVLICLQHFREMGLVMQ
RKRKSRRFYPTYLAINLANRANASVTNVTNSRGFILAETNFRVYAYTDSELQYSILSLFC
KMLYRFPNVCVLQLTRKSIQSAVVNGITADQILHYIKANAHPDMLKNDPIIAPTLADQVR
LWAMERDRLTYRDGVLYNQFLAQKDFEVLRNYAKELGALIWENSSKRYMVVTKDGHDQVK
RYWKKYKKESDT
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atggaatctggttgcgaggttaccaagtattgctccagcaagaaaatcaacgggaacgaa
agtgcttgccacgaaatggaagtatcaaacggacccaagagattactgcacaagcaaacc
gttgaagttccctcaagtgatccttgttgtagcaaccacacatgtcaatgtagctgtcca
gatgattacgtaccacctccagataaagacactttaaaaccctatgaagaattggatgtt
gaagacaagtgttgtgctaattggacaatcaagtgtgaagcatgtcttcttcaaaatggt
agttctgtagcagttggtgaaagcattcaagttgatgatggaagtggttgtgtggttgat
aagtattgctcgagcaagaaaatcaacggaaacgaaagtgcttgttacgaaatgaaagta
tcaaacgacccaagagagaagtgtcagccaaaggcagaatttgaatcaactgtttgtgga
gcatatcaacatgcagttgaagttgtttacagcagggatacaatcgacccggaaccttgt
tgttcagaatttgaatgtgtttgcaacaatcatacgatgctgtctaaacaatgtccaaag
tggttcaattacacttgtccagatccgagaatgattgcacaacaaacaaacatcattgat
gacaaacaatgctgtccggagtttaaatgtgtttgcccacaatgtccgaacgttacggag
tgtcaacgtaaatcgtggtcaccaaaagttatagacgattccacttacccagctgagtgt
ggatgtttaagcacagaatgtgaatgcaatccagaatactgttccatattttttccccaa
ccccaatgcaatgaaccacattataatcgcactgttgtcaacgctacctactatgaggaa
tgttgcccacgtgttgagtgtacatgtgtgcaggagaactgcgctaacatcacttatgaa
ggaccaagtagttgttctccatttgaagacttgattgaattgaaccagccagcaatcgaa
tgctgtacaaagcacactgcgtgtcgatgcaaaaacgaaagtcaactgaacgagctatgc
atgtcaagcaatgcaacgataccagctggattcgtctatgcaccaatattgaacgattct
accatgcgacccaattgctgtcattatgtctgtgatacttgcaaggctaaagatggatca
attaaaaagcgaggtgagacttgggttgaagatgattctggttgcggggtggagtatctc
tgcactgataagaaagaggaatatggagacagatgtttcatccgaaatggaactgttgaa
gtcccctcaagtgatccttgttgtagcaaccacacatgtcaatgtagctgtccagatgat
tacgtaccacctccagataaagacactttgaaaccgtatgaagaattggatgtagaagac
aagtgttgcgcaaattggacaatcaagtgtgaagcatgtcttctcgaaaatggtagttct
gttgcagttggtgaaagcattcaagttgatgatggaagcagtgaaggggggagatcatat
tccatcattactgctaagggattccaatttctattgttggataacgcatcacaagtttgg
tattttgtccttgaatatttggactgggttcgagagcgaggaatgaacttggttccaatc
cttcgatttatctttgaacttagtttctcttcacctggaaaggacctaccaactgacggg
agagatgaccatgttctcatatgcctccaacatttcagggagatgggacttgtaatgcaa
agaaagagaaagtcgcgccgtttctaccccacttaccttgctattaacttggcaaaccgg
gcaaatgcgtcggttacgaacgtgacgaacagtcggggctttattttggctgaaactaac
tttagagtctatgcttatacagattcagaactgcagtattccatcttgtctctattttgt
aaaatgttgtatcgtttcccgaacgtatgtgttctacaactgacgcgtaaaagtatccaa
tcagctgttgtgaacggaataactgccgaccagatcctacattatattaaagctaatgcg
catcctgatatgctcaaaaatgaccctattatagctcccacccttgcggaccaggttcga
ctatgggccatggaaagagataggttgacatatagagatggtgtcctgtataaccagttt
cttgcacagaaagattttgaagttttaagaaactatgcaaaggaacttggcgccttaatt
tgggaaaactcatccaaaagatacatggtggttacaaaggatgggcatgaccaagtaaag
agatattggaaaaaatataaaaaagaatcagacacttga

DBGET integrated database retrieval system