KEGG   Ciona intestinalis (sea squirt): 100187540Help
Entry
100187540         CDS       T01056                                 

Definition
eukaryotic translation initiation factor 4E type 3-like
Orthology
K03259  
translation initiation factor 4E
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:cin03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cin04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 233 aa AA seqDB search
MAKALFAGGVDVEHIFGNKFNKASRDRSSSPVPMVNGESPKLSRKAISNLGDTEKTGVPL
NSAWTLWLDRSVPNLTASEYEANLRKIYTVSTIESFWGVYNHIPPPSRLIPRYSYHLMRN
NIRPVWEDEVNANGGMWKLRCHKSVTDNVWNELLLSCIGEQFTGYVNKGDDIIGLSVSIR
KNDDLVQVWNINSSNIEQCKVLEKIKEVLPHVIFETSFYKPHQLHRAFEGRKM
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagctctgtttgctggtggtgtggacgtagaacatatatttggcaataagttc
aataaagcaagtcgtgataggagttcttcacctgtgccaatggtcaatggtgaatctcca
aagttgtcgcgaaaagcgatttcaaatcttggagacacagagaaaactggagttccatta
aattcagcatggactctctggttggacagatctgttccgaatctaactgcgtctgagtat
gaagcaaatttgagaaaaatttacacagtttcaaccattgagagtttctggggtgtgtat
aaccatatacctccaccaagccgactgataccgaggtatagttatcacttgatgagaaac
aacattcgaccagtttgggaagatgaggtgaatgctaatggtggaatgtggaagcttaga
tgccacaaatctgttactgacaatgtgtggaatgaactgctactgagttgtattggtgaa
cagtttactggttatgttaataaaggtgatgacattattggtctaagtgtaagcattcga
aagaatgacgacctcgtccaagtatggaatatcaactcatccaatatagaacaatgcaaa
gtactggagaaaatcaaagaagttttgccacacgtcattttcgaaaccagtttttacaaa
ccccatcagttacacagagcctttgaaggaagaaaaatgtaa

DBGET integrated database retrieval system