KEGG   Ciona intestinalis (sea squirt): 101242026Help
Entry
101242026         CDS       T01056                                 

Definition
polyprenol reductase-like
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101242026
    1.3.1.94  polyprenol reductase
     101242026
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 299 aa AA seqDB search
MLYVNYSYVLGFPVTVMNCFWVVISAIFFTTLVLNHVLAIKSKVSQFLAQYGKAKSIHVD
FDIPKRWFTHFYVVASSFNLISLVSIIAGCTGSLFYMSLFSWMNIHASVTPTGDRLSLVI
AVLLLTIQSLRRLYECLYVSMFSKTAKLMFVHYIWGLLYYPFVTATVVSECFPIYHLSVG
YLTWKHCFGILLFIAATMIHHQSHQIFANLRKKGGVKPNSHGIPQGGLFYLVSCPHYFAE
LLIYISIYLVVGHMCKSFMLILIYNFIIHCNLALDSHKWYKESFPNYPPQRKALIPYLL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatgtcaactatagttatgtccttggctttcctgtaacagtaatgaactgcttt
tgggtggtgatatctgcaatattcttcacgacattagtgttaaaccacgtattagcaatc
aaaagcaaagtttcgcaatttctagcacagtatgggaaagctaaatctatacatgttgat
tttgacataccaaagcgatggtttacacatttctatgtagtggcttcaagtttcaatctg
atttccctggtttctatcattgctggctgtacaggttcattattttacatgtctcttttc
tcttggatgaatattcatgcttctgtaaccccaacaggtgacagattatcgctggttatt
gctgtattactgctgacaattcaatcactccgtcgtttgtatgaatgtttatacgtgagc
atgttctcaaaaactgcaaagctaatgtttgtgcactacatatggggcctgttgtattat
ccatttgtgacagcaaccgtggtgtcagagtgtttcccaatatatcatctgtcagtagga
tatttgacctggaaacactgctttggaattctacttttcatcgctgctacaatgatacac
catcaaagtcatcagatctttgctaatttaagaaaaaaaggtggagtgaaaccgaactct
catggaatacctcagggtggtttattttaccttgtatcttgtccccactacttcgcagag
cttctaatttatatttccatttatcttgtcgttggtcacatgtgcaaatcgtttatgctg
atcctaatttacaactttattattcactgtaacttggctttggacagccacaaatggtac
aaagaaagttttcctaactacccgccccaaagaaaagcacttataccctacctgctttaa

DBGET integrated database retrieval system