KEGG   Ciona intestinalis (sea squirt): 101242901Help
Entry
101242901         CDS       T01056                                 

Definition
josephin-1-like
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101242901
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C86
   101242901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 221 aa AA seqDB search
MFCILIIISTSLIIIVMSCLALRGSHPDEPAPRKVYHERQHFELCALHALNNVFQDPNAF
TKEQLDEICSRLSPDTVLNPHKSMLGTGNYDVNVIMSVLQSKGHAAVWWDKRRSLERLCL
TNIKGFILNIPSTIGWGVLTIPLKRRHWIAVRAIENMFYNLDSKLKQPEVIGEAAQLKKF
LAKKLSSKNCELLLVVSTEVEVVRGWKEGNSPTNSLSQLES
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgttttgcattttaattataatttcaacctcgttaataatcattgtcatgtcgtgtctc
gctttgcgtggaagccaccccgacgaaccagcacctcgcaaagtttaccatgaacggcaa
catttcgaattatgcgcgctacatgcgttaaacaatgtatttcaagatcccaacgctttc
accaaagaacaactcgatgaaatttgttcaaggttatcacccgatactgtattaaaccca
cacaaaagtatgttgggcaccggtaactacgatgtgaatgtcatcatgtcagttcttcaa
agtaaaggtcacgcagccgtttggtgggataaaaggaggagtcttgaaagattatgttta
acgaacatcaaaggatttattttaaacattccgtcaacaattggatggggtgtgctcacc
atccccctcaagcggcgacattggattgctgtccgtgccatagaaaacatgttttacaat
cttgattcaaaactgaaacagccagaagtgattggcgaggctgcgcagttgaagaaattt
cttgctaaaaaattatcgtcgaaaaattgtgaactattgttggttgtgtcgacggaagta
gaagtggttcgtggatggaaggaggggaactccccaaccaactcactgtctcagttagaa
agttga

DBGET integrated database retrieval system