KEGG   Ciona intestinalis (sea squirt): 445594Help
Entry
445594            CDS       T01056                                 

Gene name
ciap
Definition
endoderm-specific alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cin00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 579 aa AA seqDB search
MLDMMFHQGLLLLCASVAVIGQDLTEKSAAYWEQVSEAELLETLQYQKLNIKKAKNVIIF
IGDGMGVTTVTAGRILKGQNSGASGEETKLAMDKLPYTGVSRTYSVNRQVSDSASTATAF
LTGVKTNDYVLGLNGNSVKGICAGSINESNLLTSVLLEAKMAGMSAGIVTTTTINHATPA
AAYANSPDRLWYSDAEMTAEAKENGCKDIAQQFIDKSDQFTVVLGGGRQYFKPNTTFDVE
YTDRANLRLDGQDLIEVWKAKQSDRNSAYVWNKEQFDQVDVAKTDSLLGLFEPSHMNYEA
HRAQDGAGEPSLKDMTSKAIRMLKKNDQGFILLVEGGKIDHGHHAGKAYLALHDLVALDD
AIEAAVEMTSDDETMIIVTADHSHVFTIGGYSHRGNPIFGAAPNVNNPKLVDDGKPFTTL
LYGNGPGHSTLNGVGSCERENITLIATDDPNYKQQSAVPLPSETHGGEDVVIMARGPMAH
LFEGVHEQSYIAHIIRYATCIGKKSKNCAAQLEQSTDLIFVSFLGFRLSSGQAQLALYIT
FGLLMAACIIAIAANLQLCRMARQSARKHEDPKVLNEKV
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgttggatatgatgttccatcaagggctactgttactttgtgcaagtgttgcggtaatc
ggtcaagacttgacagaaaagtcggccgcctattgggaacaggttagcgaggcagaacta
cttgaaacacttcaataccagaagctaaatatcaaaaaagcaaagaatgtcattatattt
attggtgatggaatgggcgttacaacagtaacggcgggacgaatccttaaaggacagaac
tctggtgcttcgggcgaagagacgaaactcgctatggataaattgccgtacactggagtt
tcaaggacgtactccgtgaacagacaagtatcagactctgccagtacagcaactgctttt
ctaacaggcgtgaaaacgaatgattatgttctcggcttaaacggtaactcagtcaaaggc
atttgtgctgggagcataaatgagagcaatcttctaacgtctgtattacttgaagctaaa
atggcaggtatgtctgctggcatcgtaactacgacaacaataaaccatgccacgcctgct
gctgcgtatgctaattcaccagaccgattatggtacagcgacgctgaaatgactgcagaa
gcaaaagaaaatgggtgcaaagacattgctcaacagtttattgataaaagcgaccaattc
acggttgttcttggtggcggacggcaatactttaaaccgaacacaacatttgacgtcgaa
tatacagatagagctaacttaagattagatggacaagatttaatcgaggtttggaaagca
aagcaaagcgaccggaattcagcatacgtttggaacaaagaacagtttgatcaagttgat
gttgcgaagacagattctctgctaggtctttttgaaccgtcacacatgaactatgaagcg
caccgggcgcaagacggcgctggagagccttctctgaaagatatgacctcaaaggctata
cgaatgctcaaaaagaacgatcagggttttattcttttagtagagggcggaaaaattgac
cacggtcaccatgcaggaaaggcttatcttgcgctccatgatctcgttgcgcttgatgac
gcgattgaagccgcagttgagatgacgtcagatgacgaaacaatgatcattgtgacggcg
gatcacagccatgtttttactattggtggctatagtcatagagggaatcctattttcggc
gccgctccaaacgttaataatccaaagctagtcgatgatggcaaaccattcaccacactt
ctgtatggtaacggtccggggcatagcactttgaatggtgttggctcttgtgaaagggaa
aacattacgctcattgcgacagacgacccaaattataaacaacaaagtgctgtaccgtta
ccatctgaaactcacggtggggaagatgtggttataatggctcgtggaccaatggctcat
ttatttgaaggagtacatgaacagtcttacattgcacatattataagatatgcaacatgt
attggtaaaaaaagcaaaaattgcgccgcacaactcgagcagtcgactgatttgattttc
gtcagttttttgggatttagactatcttctggacaggctcaactagcgctgtacattaca
tttggcttgctgatggccgcttgcattattgcaatagccgccaacttacaactttgcaga
atggcacgacagagcgcaagaaaacacgaagatccaaaagttttgaatgaaaaagtctga

DBGET integrated database retrieval system