KEGG   Ciona intestinalis (sea squirt): 619278Help
Entry
619278            CDS       T01056                                 

Definition
thrombospondin A
Orthology
K16857  
thrombospondin 1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Phagosome
TGF-beta signaling pathway
ECM-receptor interaction
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:cin04350]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:cin04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:cin04145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 1168 aa AA seqDB search
MRIAWILAFLGLVAAARAVGLSAVNAFDLFSMTGISHKRSQPAYRRAITTDGSSPDHFFP
AYKFKRPLGPHALVATDDQFRLLSASLARIDTFYFSANMKQRMNNVGTLISISPTVSMAQ
AVNTMAIVSDAPQDRLDLFYTVGERNHVLTFTNVGIANSLKEWKNMTMEFSGYDVTLYVN
CRNVGTRRLESEFYRRLDAGSSRISLATAYENKDDFKGSLQNVRFRFGSRVEANPMLCDS
QSTPSNIESNRSEFDPEFDVAPSRNAGPSHHDNVLPGSNTMARQFVLQVVQDSCELTCRP
PQGAKRPDDLEVFFSCMDATGMHKNGERWNVDDCVSCVCDGGHRLCSNQTCPLLHCLNVT
RVPGECCPKCQAETDGFSAWSSWSECSVTCGIGSQTRGRSCDRANFPCNGPTLENRNCLR
DPCKRRRDGGWSFWTRWAPCSVTCGRGRSTRIRECNAPIPELDGEECLGPDRQTKDCREA
PCAVNGGWGTWSPWKRCSVSCGTGFRTRKRKCNNPKPRYGGKACPGDKKEVGQCNTQNCP
VDGCLASPCFGGVKCTSYDDGSFTCGSCPAGTQGDGINCQDIDECTLVADACFHYQGVHR
CQNHFPGYSCLPCPSGYRGDVQSGVGVIHARAHKQECVMSNPCTDGANPCPENAECIFLG
KTVSPPFICKCRPGYASCSHCDGLICADDTDLDGWADNEIVCPGSNTSVTCHEDNCPRLP
NSGQEDSDEDGEGDACDRDDDNDGIYDEQDNCQFIYNPYQSDVDRDGVGDMCDNCVHDRN
ADQKDTDGNGEGDACSLDIDGDSIENIFDNCVYVYNFDQLDSDMDGVGDACDNCPLVHNP
SQEDRDSDKVGDSCDSNLDVDEDGIQNNLDNCPYIANANQADHDNDGLGDACDPDDDDDG
IPDDRDNCRLVVNPSQLDTDGNGRGDACEGDFDGDNIMDADDACPLNNKISVTDFRSFDM
IALDPEGIAQIDPNWVVRNKGKELIQTKNCDPGLAIGMDRFEAVDFSGTFFVNTEKDDDY
AGFVFGYQSSSKFYVVMWKQVSQTYWKNYPSRAHGYSAIQVKVVNSTSGTGEALRNALWH
TGDTKNEVRTLWYDDMQQGWRDYTAYRWTLQHRPETGFIRVTMYEGKDLLVDSGALYDKT
FAGGRIGFFIFSQEMVFFSDMEYMCKDT
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atgcgaattgcttggattctcgcttttctaggactcgtcgcagccgctcgagcggtcggc
ctgtcggcggtaaatgctttcgacctcttttcaatgaccggcatctcgcataagagatcc
caacctgcatacagacgagctataactacggacggaagcagtccagatcatttctttccc
gcatacaaattcaagaggcctctcggaccacatgctctggtggcaaccgacgaccaattc
cggcttctttcagcgtcgctggctcgcattgacactttctacttcagcgctaatatgaag
cagagaatgaacaacgtcggcacccttattagcatctccccaacagtgagcatggcacaa
gcggtcaatactatggcgatcgttagtgatgccccacaagacagacttgatctcttttac
accgttggtgaacggaatcatgttttgaccttcacaaatgtgggtatcgccaattcactg
aaagaatggaaaaacatgaccatggagttcagcggttacgatgtgacgctgtacgttaac
tgccgcaacgttggcacacggcgattggagagcgagttctacaggcgtctggatgctggc
agcagccgaatcagtctcgcaactgcctatgaaaacaaggacgattttaagggatctctt
cagaacgttcgatttcgatttggttcgagagttgaagccaaccctatgctctgcgactcg
caatctacgccaagcaacattgaaagcaaccgttcagagtttgacccagagttcgatgta
gcgccatcccgcaacgcgggtccttctcaccacgacaacgttctgcctggcagtaatacc
atggcgcgccagtttgtgctgcaggtcgtccaagattcttgcgagctgacatgccgcccg
ccgcaaggagcgaaacggccggacgaccttgaggtgttcttctcttgcatggatgccaca
ggcatgcacaagaacggagagagatggaacgttgacgactgcgtgtcttgcgtatgcgat
ggtggccaccggctatgttcaaaccaaacctgccctcttctacactgcctcaatgtgacg
agagttcccggagaatgctgcccgaaatgtcaagctgaaactgatgggttttctgcatgg
tcaagctggtcggaatgtagcgttacttgcggaattggaagccagacaagaggccgatct
tgcgacagagctaactttccatgcaatggaccaacgttggaaaaccgaaactgccttaga
gacccatgtaaacggcgccgtgatggaggttggtcgttctggaccagatgggctccatgc
agtgtaacttgcggtagaggcagatccaccagaatccgtgaatgtaatgcaccaattcca
gagttggacggtgaagaatgtcttggacctgacagacaaaccaaagactgcagagaagcg
ccttgtgcagttaatggcggatggggtacctggtcaccatggaaacgttgtagtgtttca
tgcggaacagggttccgcacgcgaaagcgaaagtgtaacaacccgaaaccgaggtacggc
ggaaaggcgtgcccgggagacaagaaggaagtcggccaatgcaacacacagaattgccca
gttgacggttgtttggcgagcccttgcttcggtggtgtgaaatgcacttcgtatgatgat
ggtagtttcacttgtggttcatgccccgctggaactcaaggtgatggcataaactgccag
gacattgacgagtgcactctggttgccgacgcctgcttccactatcaaggcgtgcataga
tgccagaaccacttcccaggctattcgtgtcttccctgcccgtccggatatagaggcgac
gttcagtctggagtcggcgtcattcacgcccgtgcccacaaacaagaatgcgtcatgtcc
aatccatgcacagacggggcgaacccctgcccagaaaacgcggaatgcatattcctcggc
aagaccgtcagcccaccattcatttgcaagtgtcgaccaggctacgcgtcatgctcacat
tgcgatggtttgatttgtgcagatgataccgacttagatggctgggcagacaacgaaatc
gtatgcccaggcagcaacacttcagttacatgccacgaggataactgccctcgactgccg
aatagcggacaagaagattcggacgaagatggcgaaggcgatgcttgcgacagagatgac
gacaatgatggcatatatgacgaacaggataactgtcagttcatatacaacccgtaccaa
tctgatgtcgaccgagacggtgttggagacatgtgcgataactgcgtgcatgataggaat
gcagaccaaaaggataccgatggtaacggcgaaggggacgcttgctctcttgatattgac
ggcgactccatcgagaacatattcgacaactgtgtttacgtttacaattttgatcaactc
gatagcgacatggatggagttggtgatgcatgtgacaactgtcctctggtacacaacccg
tcacaggaggaccgagattccgacaaagttggcgacagttgcgactcaaacttagacgtc
gatgaagatggaatacaaaacaatttagacaactgcccatacattgcaaatgccaaccaa
gcagatcacgataacgacggtttgggcgacgcgtgtgatccagatgacgacgacgatggt
atcccagatgaccgagataactgcagattggttgtcaacccaagccaactcgatactgac
ggtaacggcagaggcgacgcttgtgagggcgactttgatggtgataatatcatggatgcc
gacgatgcttgtcctttgaataacaagataagtgtaactgacttcaggagcttcgatatg
attgctcttgacccagaaggtattgcacaaattgatcctaactgggttgtgaggaacaag
ggtaaagagctcattcagaccaaaaactgcgaccctggactcgccatcggaatggaccgg
tttgaggcggttgattttagcggaactttctttgtcaacactgaaaaagatgacgattac
gcgggttttgttttcggatatcaatcttccagtaaattctacgtagtcatgtggaagcaa
gtatctcaaacctactggaaaaactacccatcacgtgcccacggatacagtgccatacaa
gtcaaggttgttaactcaacttcaggaacaggcgaagctcttagaaacgcactttggcac
accggggacacgaaaaacgaggtacgaactctttggtacgatgatatgcagcagggctgg
agggattataccgcttacagatggaccttacaacacagaccagaaactggtttcatcaga
gtgacaatgtacgagggaaaagatcttttggttgactccggtgcgttatacgataaaaca
tttgccgggggaagaattggattctttattttctcgcaagagatggtgtttttctcggac
atggaatacatgtgtaaagacacgtaa

DBGET integrated database retrieval system