KEGG   Ciona intestinalis (sea squirt): 664632Help
Entry
664632            CDS       T01056                                 

Gene name
gamt2
Definition
guanidinoacetate methyltransferase 2
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cin00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cin00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 235 aa AA seqDB search
MSTSQNKIFNQGEDCKPSWTSAGADYNEKDTHLEIMGKPVMERWETPYMHLLATIASSKG
GKVLEIGFGMAIAASKIQSHEISEHWIIECNAGVFDRLQTWGKDQPHTVVPLKGMWEEVV
PILPSGHFDGILYDTYPLSEEDWHTHQFGFIKNHAKRLLKPGGVLTYCNLTSWGELMKTK
YTDIEQMFQETQVPHLVEAGFMKNKITTQVIDNQPPQDCKYYSTSKMIGPTIINE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacatcgcagaataaaatctttaaccaaggtgaggattgcaaaccatcatggaca
tctgccggtgctgattataatgagaaagacacccatctagagatcatgggcaaacctgtt
atggagagatgggagacaccttacatgcatttacttgctactattgcttctagtaaaggt
gggaaagttttagagattggttttggaatggcaatcgcggcgagtaagatccagtcacat
gaaatatccgagcattggataattgaatgtaacgctggtgtgtttgatcgactgcaaaca
tggggcaaagatcaacctcatacagttgttccattaaaaggaatgtgggaagaagttgtt
ccaatattaccaagtggtcattttgatggtatactgtatgatacatatccactatctgag
gaagactggcacactcaccagtttggtttcatcaaaaatcacgccaaacgtttgttgaag
ccgggtggtgttcttacttattgtaatctaacatcatggggggaattaatgaagacaaaa
tataccgacattgaacaaatgttccaggaaacccaagtaccccacctagtggaagcaggg
tttatgaaaaacaagataacaactcaagttattgacaatcaaccacctcaggattgtaaa
tattattcaacatcaaaaatgatcggacctaccattattaacgagtag

DBGET integrated database retrieval system