KEGG   Ciona intestinalis (sea squirt): 751565Help
Entry
751565            CDS       T01056                                 

Gene name
zf(fyve/c2h2)-2, Ci-ZF(FYVE/C2H2)-2
Definition
zinc finger protein ZF2
Orthology
K12478  
early endosome antigen 1
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    751565 (zf(fyve/c2h2)-2)
   04145 Phagosome
    751565 (zf(fyve/c2h2)-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1494 aa AA seqDB search
MFNRIRKNLGNKDKDSTPTSPKNDVQQKPPVSEQSGFICPMCMVGLPTPEALQIHFDYEH
SVPNSDSSNEKSNDKPKKTENKNFAPSATAPPVDASLATPSVTPQNQLSNVNGFANVEHV
NNVSASQNAGLPNVTELEAEIKDLQASLTDEKWYTTELKKEYDSLKEEHSNTCTDLENTK
QQMKIALATNEELARQKEELNQKAAKMAEAVADLQAKKDEFEREKEAACQRSENQSVELE
KAATWVRDLESQLPSSNAHDDTTKLQRPGADDVMVLKKELVSVQTLMDQMTRESEDKSHK
VEEERQHLQQLLDEARQQALLTQEEFDKYKAENERLKGENLEKEVEKDESKKLFAVETEK
LRLLHADMDEIRKEELNNVSAALEKESSYSLLLEKEVNKLKEEKSEMKKQLQKLNEDVQS
ALEKSISSDKLMEETRTESDLLKMEKWEVENQLKSAEETQKSLKEKSETELTEMNARYES
LICECDDLKSQINKSHEQCEDWRIKNETLALEFNQFKLVNKQLELESSGAKQQIEIQLSQ
INGKLEAVEAENKQLNDDKRKMSEDLQVMRASHQDERKLIEAKLLDSEKLVLQLKLQTTR
FEEESSQRSRVIETSEQKLTFVQSACDELKEKIHGLETELALGNHEIASLKDQLTSSASK
LENETQRREDAIGEVTKLRDERNNLITKIEVGDGEAAAHSQLQEENNKLRKQKEEAEEKV
REVESEKEESLRTLSSKINDSQSIIVTLQNKVLELDDDLTKQRTLKEEAEEENLKIESEL
KEKTDTLLNVQATSISHQAEASNEINNLRRNLEEEINEKKSNSEKLKSTELQLSNVQSQI
SEMREKHRKESSQLKEELHLSSAATQEARVEVELTIDSVGGEIQTKVKELGELKAINEQL
QLNIDKSAENIENLNQEHSATMCELNNVSMELEEAKKKLSQLETSECKTKESLEELEGKI
NMLGEENKKMEEQNMDLEKLLEATRESKSVLQQTIMTSQSRIEQLQNEKENVKEMLNQVK
VEHGSEHERLLEQIEGHKTTVTKMEEEISLLNKQISDHKSQFEEKVLDNQSKDAEIEKLT
SKLENMSAELTASEAVLQNTFVELEATKVESETLVTRSKELTDSKSEIEEKLETSRSQVV
ELNETLEKKDVKLDEMKVSVDLLEKKYQSMKEEKEVEVDELKHKHQELSDMVVSLEEELE
NLKKKFSQVNESLAEEEKENKRIQEEEEKKRRERLNEQLSTLEEAQSLLISSKVALQSEL
KSLKETSLSEKESLERAAEMDKTVIQLKEDNISKLKVQLEEKSRLLETNEADRVVNESRL
QLEIGALSENLSNARSEWRVTSQSLDVVRAECDDLRGQVVILQTNAHSNADERRALLERC
LNAEQQVEQLQVNINQLVKKLDDAHSAMHELGRENQALQVKHTTTISKKWTDDRSTAECR
ACNRAFSITVRKHHCRHCGEIFCGECSSRTATVAASKNPVRVCERCYDDLLVAG
NT seq 4485 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacagaataaggaaaaatcttggaaacaaagataaagattctacaccaacctct
ccaaaaaatgatgtgcagcagaaaccacctgtctcggaacaatcaggtttcatttgcccg
atgtgcatggttggtctgcccacaccagaagctttgcaaattcattttgactatgagcat
tcggtaccaaactcagattcatcaaatgagaaatctaatgataaaccaaaaaagacggag
aacaagaattttgctccatcagccactgctcctccggtggatgcttctttagcgacacca
agtgttactcctcaaaatcagttatctaacgtgaatggtttcgccaacgttgaacatgta
aacaatgtatcagcatcccaaaatgcagggcttcccaatgtaactgaactagaagctgaa
attaaagatctacaagcatccctcactgatgaaaagtggtataccactgaactcaagaaa
gaatatgattcacttaaagaggaacattcaaacacttgcactgatttagaaaatacgaag
cagcaaatgaaaatagcgctggccactaatgaagaactagcaagacaaaaagaagaactc
aatcaaaaagctgcaaaaatggctgaagcagtagcagatctacaagccaagaaagatgag
tttgaaagagagaaggaagctgcttgtcagcgaagtgaaaatcaaagtgtggaattagag
aaagctgcaacgtgggtgcgagatcttgaatcccaacttccatctagcaacgcacatgat
gatacaaccaagcttcaacgacctggtgctgatgatgtcatggtattgaaaaaggaatta
gtctctgtgcagactctaatggatcaaatgacgagagagtccgaagataagagtcacaag
gtggaggaagagagacaacacttgcagcaattgctcgacgaagcgcgtcaacaggcgctg
ttaactcaagaagagttcgacaaatataaggcggagaatgaacgcttaaaaggtgaaaac
ttagaaaaagaggttgaaaaagatgaatcaaagaagttgtttgcggttgaaactgaaaaa
ttgaggttactacatgcggatatggatgaaatcagaaaggaagaattaaacaatgtgagt
gcagctttggagaaagagtcttcttattctttgctgttggaaaaagaagtgaataaattg
aaagaggaaaaatctgaaatgaaaaaacaattgcaaaaattaaatgaagatgttcaatct
gcattggaaaagtcgatctcatctgacaaacttatggaagaaacaagaacagagtcggat
ttgttgaaaatggaaaaatgggaagtggaaaatcaattaaaatctgctgaagaaactcaa
aaaagcctgaaagagaaaagtgaaacggaactaacagagatgaatgcaagatatgaatcg
cttatatgtgaatgtgatgacttgaaatcacaaataaacaaatctcatgaacaatgtgaa
gactggagaatcaagaatgaaactttagctttagaatttaaccaatttaaattggtaaac
aaacaactagaattagagtccagtggagcaaaacaacaaatagaaattcaactttctcaa
ataaatggaaaactagaagctgtggaagctgaaaataaacagcttaatgatgataaaaga
aaaatgagtgaagatctacaagttatgagggcgtcgcatcaagatgaacgaaaactgatt
gaagcaaaattattggattccgagaaattagtcctacaacttaaactacaaacaactcga
tttgaggaagagtcaagtcagagaagtcgtgttattgaaacatcggaacaaaaattaact
ttcgttcaatctgcgtgcgatgaactgaaagagaaaatacatggattggaaacagaactc
gctcttggcaatcatgaaatagcttctttaaaggatcaactgacatcttctgcatctaaa
cttgagaatgaaacacaaagaagggaagacgcaattggagaagttaccaaattacgtgat
gagagaaataatctgataactaagattgaggttggagatggagaagctgctgctcattct
caactccaagaggagaacaataagttaaggaaacaaaaggaggaggcagaggaaaaagtg
agagaggttgagagtgaaaaggaggaatcgttacgaactctgtcatccaaaatcaacgac
tcacaatccatcattgtgacattgcaaaacaaagttcttgaacttgatgatgatttaacg
aaacaacgaacattgaaggaagaagctgaagaggaaaatttaaagatcgaatctgaactc
aaggaaaagacagacacgctactgaacgtacaagccacaagtatttcccaccaagctgaa
gcaagtaatgaaataaacaatttacgaaggaatttggaagaagagataaatgaaaagaaa
tctaattcggagaaacttaagtcaactgagttgcaactgtctaatgttcaaagtcaaata
tctgagatgagggagaagcacagaaaagaaagttcacagttaaaggaagagttacatctt
tcatctgcggccacccaagaagcaagagtggaagtggaattgacaatagattcagttggt
ggggaaatacaaactaaagttaaggaattaggcgaattgaaagctataaatgaacaacta
caactaaatatagacaagtcggcagaaaacatcgaaaatttaaatcaagagcacagcgcc
acaatgtgtgaattaaataatgtttctatggaattggaagaagcaaagaagaagttgtcg
caattagaaacttccgaatgtaaaactaaagaaagcctggaagaattggaaggaaagata
aatatgctgggggaggaaaataagaagatggaagagcagaatatggatttggagaaattg
ttggaggctacaagagaatcaaagtctgtgttgcaacaaaccattatgacatcacagtca
cggattgaacaattacaaaatgagaaggaaaatgtgaaagaaatgttgaaccaagttaaa
gttgaacatgggagtgaacatgagagactgttggaacaaattgaaggccacaaaactact
gtaactaaaatggaagaagaaatttctcttcttaataaacaaattagcgatcataaatct
caatttgaagaaaaagttttagataatcaatcaaaagatgcagaaattgaaaaattaaca
tcaaagttagaaaacatgtctgcagagctaacagctagtgaagcagtgttgcaaaatact
tttgtcgaacttgaagcaacaaaagttgaatcggaaacactggtaactagaagcaaggaa
ctcactgactcaaaatctgaaattgaagaaaaattggaaacttctagaagccaagttgtt
gaacttaatgaaaccttagaaaaaaaggatgttaaactggatgagatgaaggtttctgtt
gatttattggagaagaaatatcaatcaatgaaagaagaaaaagaagttgaagttgatgag
ttgaaacataaacatcaagagcttagtgacatggttgtatcacttgaggaagaattagaa
aatctcaagaaaaaatttagccaagttaatgaaagcttagctgaagaggaaaaagagaat
aaaagaatccaagaagaggaggagaaaaagagaagagaacgactaaatgagcaactttca
acactagaggaggcacagagtttgttaatttcaagcaaggtggcgctacagagcgagtta
aagtcgttgaaagaaacttcactaagcgagaaggagtcattggagcgtgcggctgaaatg
gataaaactgttattcaattaaaagaagataatatttctaaacttaaagttcaattggag
gaaaaaagtcgattattagaaaccaatgaagcggatcgtgttgttaacgagtcacgactc
caactcgagatcggagctctaagtgaaaacctaagtaacgctagatctgaatggagggtc
acgtcgcaaagcttagatgtggtgagagctgagtgcgacgatttaagaggacaagtcgtt
attttgcagacaaacgctcatagcaatgctgatgaacgtagggcattacttgagcgatgt
ttaaatgctgaacaacaagttgaacaacttcaagtcaacatcaaccagttggtaaagaaa
ttagatgatgcacattcagccatgcatgaactaggaagggaaaatcaagctttacaggtt
aagcacacaacaacgatatcaaagaaatggacagatgatagatcaactgcagagtgccgc
gcatgcaatcgggccttttcgatcactgtgcgcaagcatcattgtcggcactgtggtgaa
attttctgtggtgaatgctcatcaagaactgctactgttgctgcatccaagaatcctgtt
cgtgtatgtgaacgttgctatgacgatttgctggtggcaggctaa

DBGET integrated database retrieval system