KEGG   Ciona intestinalis (sea squirt): 751572Help
Entry
751572            CDS       T01056                                 

Gene name
zf(ubp)-3, Ci-ZF(UBP)-3
Definition
zinc finger protein 3
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     751572 (zf(ubp)-3)
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   751572 (zf(ubp)-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 993 aa AA seqDB search
MDKAKKSPDSKINCKTSEDTQILSKNDSSPSEVKNITKCTRFRLSREYELRICNCKHILR
MTVGERHSVVNPQRWLCNVCFTTESVWACLSCPNVACGRYIHEHALNHYLETQHPLAIDV
NELYVYCYACEEYVLNDNKSGDIKVLRETLQAIRYQNFTGTTRSGHTLRTATISSDEDIQ
MRRRLQQQQLDRDDRNFTAIWHSRFVRQRKAFKYWLHYVRHKSEYKDEEPVSPNISPDES
PVRMESIRLREFAVLDLKTENDETVSSSPGSKDLLPCFNTCEISSANKVNSKDLSLEMDK
VTAMQEELTMEDTCKSTQSIIEIEIDTSDTVPNDHEQLDLSHERSDNKFSADISVKGHKS
EIKSEKESNFPEGDKTESKKVSRKDSVVEATQNTDTTQTRPKRANAASRYHEIMHRLSSF
VHIEPVKKRLKLTIPTPSAGRKTSVDLEDRRRSARLIQRTCEKAKAAEKARKKKGSKKKG
KTKKSYGKSTQKAQKGQKATRVTGSSKTSHRRIRTQSGLRSLYDSIPNKAVTSLIPGVTG
LRNLGNTCYLNSIIQVLGHLQKFRLCLLALRDLDGMDEHHDSLTSPVATHSRMGRRSTME
MYENQTNVSRRMLRLQSGLNGGHDGSASSEKDSVLPSTQLPPSLSLCHELNDLYHIMWSG
KWKLVSPCHFLSSVWQLIPSFRGYSQQDAQEFLCELLDKIVSELEWKRRRPQMMVSNGLA
TRISKVVHAVFEGKLHSMVKCLECGNISSTIEPFWDLSLEFPQRYHVNAYNWKNSNQGCT
LSEMLEKFTEAEQLDGGCVYNCAKCNVTEQQVTDRCNRRRRLSSRKITQKLTEAEKQIKI
SKLPQILRFHLKRFRWSGRNHREKITVPVNFPSEFDIRQHCWSDHQSNVSAPSSSDGNFV
YDLSAVVIHHGRGFGSGHYTAYCWNDIGKFWVHCNDSNLELCSIDDVMAAQAYILFYSQR
GLDPHPHFSAPCTPDMSPPISPSDSEVFDNDIG
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atggataaagccaagaaaagtccagattcgaaaataaactgtaaaacttcagaagatact
caaatactgtccaagaatgattcttccccttctgaagttaagaatattacaaaatgtaca
aggtttcgcctctccagggaatacgagcttcgcatatgcaactgtaagcatattcttcgt
atgacagttggagagcgccactcagtggtaaatccgcagcgttggttgtgtaatgtttgt
ttcactacagagtcagtgtgggcgtgtctaagttgtcccaatgttgcttgtggaagatac
atacatgagcatgcgttgaatcattacctcgaaacacaacatcccctggcgattgacgtt
aatgaactgtacgtttattgctatgcttgtgaggagtatgtgctgaatgataacaagtca
ggtgatattaaagtactgcgggaaaccttacaggcaattcgataccagaactttactggc
actacaagaagtgggcacacactacgaactgctaccattagttctgatgaagatatacag
atgagaagaagattgcaacaacaacaactagatagggatgatcgtaacttcacagccata
tggcattccaggtttgtacgtcaaagaaaagcgtttaaatactggctgcattacgtgaga
cacaaaagtgaatacaaagatgaggagcccgtgtctcccaacatctccccagatgaatct
ccagtgaggatggaatcaattcggctgagggagtttgcagtcctggaccttaaaactgaa
aatgatgagacggtatcctcttctcccggatcaaaagatctgcttccatgttttaataca
tgtgaaatatcatcagcaaacaaagtgaattctaaagatttgtctttggagatggacaaa
gtaactgccatgcaagaagaacttaccatggaagatacatgcaaatcaactcagtctatt
atagaaattgagattgatacttcagacactgttccaaacgaccatgaacagttggattta
agtcatgaaaggtctgacaataagttttctgcggatatatccgtcaaaggacacaaatcg
gaaataaaaagtgaaaaagaatctaatttcccagaaggggataagactgaatctaaaaaa
gttagcagaaaagatagcgtagtagaagctactcaaaatacagacaccacgcaaactcgt
cctaagcgcgcaaacgctgccagtcgttatcatgagataatgcacagactttcatccttc
gttcatattgaacctgtaaaaaaacgattgaaattgacaataccgactccaagcgctggt
cgcaaaacttctgtggatttagaggacagaagaagaagtgcaagacttattcagagaact
tgtgaaaaggcaaaagctgcggaaaaagcaagaaagaagaagggaagtaaaaagaagggc
aaaacgaaaaaatcctatggaaaatcaacccaaaaagcacaaaaaggtcaaaaagcaact
cgagtgacgggttcttctaaaacttcccacagaagaattcgaactcagagtggtctcaga
tcactatatgatagcatccctaacaaagcagtcacttctttaataccaggagtcactggg
ctgagaaacttaggcaacacatgctatctaaattcaattatacaggtcttgggacatctt
cagaaattccgtttatgcttgttggcattgcgggacttagacggaatggacgaacaccat
gatagtttaacttcacctgttgctacacattctcgtatgggcagacgatctacaatggaa
atgtatgaaaaccaaactaatgtgtcaaggagaatgctgcggcttcaatcaggtttaaat
ggtggtcatgatggcagtgcttccagtgaaaaagattcagtgttgccatcaacacaactt
cccccttccctttctctttgccatgagttaaatgacctttaccacataatgtggtcgggc
aagtggaagctggtgtctccatgtcacttcctaagttcagtgtggcaactcattccttcg
tttcggggttattctcagcaagatgctcaggaattcttgtgcgagttgctcgataaaatc
gtctccgaattggaatggaagcgcagacgacctcaaatgatggtttccaatggtttggca
accaggatatctaaggtggttcatgcagtgtttgaaggcaaacttcacagtatggtaaag
tgtttggagtgtggtaatatatcaagcactattgaacccttttgggatttgtcgctagaa
tttccccagcggtatcacgtcaatgcatacaactggaagaacagcaaccaaggatgtact
ttatcggagatgttggagaaattcactgaagcagaacagctcgacggtggatgtgtgtac
aactgcgctaaatgcaatgttacggaacaacaagttacagatcgttgcaaccgtcgtagg
cgactttccagtcgtaaaataacccagaaactcactgaagcggaaaaacaaatcaaaatc
tcgaaactgccacaaatacttcgttttcatttgaagcgttttcgatggagtggtcgcaac
caccgtgaaaaaataacggtgccagtcaattttccttcggaattcgatatcaggcaacac
tgctggtctgatcatcagtccaatgtttctgctccaagcagcagtgatgggaactttgta
tacgatcttagtgctgtagttatacaccatggaaggggctttggatcaggtcattataca
gcatactgttggaatgatattggaaagttctgggtccactgtaatgattctaacctagag
ttatgctcaattgatgatgtaatggcagcacaagcgtacatacttttctacagccaacga
gggttagacccccacccccactttagtgccccatgtacccctgatatgagtccccctatt
tcacccagtgactcagaagtgttcgataatgacattggttga

DBGET integrated database retrieval system