KEGG   Ciona intestinalis (sea squirt): 778561Help
Entry
778561            CDS       T01056                                 

Gene name
cbp, CREBBP, Ci-CBP
Definition
CBP protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    778561 (cbp)
   04330 Notch signaling pathway
    778561 (cbp)
   04350 TGF-beta signaling pathway
    778561 (cbp)
   04630 Jak-STAT signaling pathway
    778561 (cbp)
   04068 FoxO signaling pathway
    778561 (cbp)
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     778561 (cbp)
Transcription factors [BR:cin03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    778561 (cbp)
Mitochondrial biogenesis [BR:cin03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    778561 (cbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 2430 aa AA seqDB search
MADGSPPSKRQKTSDIFSLENELPEELLCGTPSGLTNGPTVSTAAPPVPTTINNGQTQPT
PPQPLPTQANTPSMPAPASTASMQNKQVTQLLQTGRGSPKYPGGTPSPVNTGTSSPRPSR
ASQPQQSPASNSLMSMQSPTGGSNINNIKSPMNSSMSVSISRSGGNMRTTPSPRVQPTLT
SSNPTMINASLPTTGVYNRNTITPQQMTQQNNLNQVQNATMQQQQQQQQLQQQQQQQPQV
FINGPMRPQMCMATVPGMNVMTRAGQPQNTMQMQTMQATPGVTNNMQTRMAFPRPNNNRI
LGNTTMVNSMVLGTQPQQPNNIPMNSQTVVGSNMQPMHIINSHDGMPIRQNMYQQKNMNM
GQPQFNINNMQQNQMTNVTMQHPQQNPNPMMRTTQMNPMQNVQQTGGMVQSGMQQVPPAG
NRMQSSGGGVVDPEKRKLIQQQLFLLLHAHRCLKNASTNEPSTCAVPHCRTMKNVLQHMN
TCTEGKQCQIAHCASSRQIISHWKQCKREDCSVCLPLKQNQSNSNNPNAMHDVTHNKPGM
FNSQINTALQSVPTPQQNQSMFIGRGNVGEPQQQPGQQITKNSHTTMALDKNKVQEVLGL
NSSWKPAPSGGALSTPSSVQNSEITSTSGQEMAGVGPMAQPRTVHQWHSQVKEELRNYLV
QKLVQNIFPTPDKISMTDVRMIKLLSFARKVEGSMYEQASSREEYYHLLAEKIYKIQKEL
EEKRQKKPLGAMNGPTSVSQQQQQQQQQQQQQQHRLAGGFMNKAPGGPSQLRMVNQVNNV
NYMDQSQVNPASNINMPTNGVVNNNNPNTPLSGTIRQFALAMKEIDSSNANRPPMTSPPL
SNSPMTITNQQFGTTSFSNQIQIPGMNNQCPPLNSSDPNIQPPNNNSMMNETTQDNSFIQ
RSQPGMNNNFQNSLPNVTTQQQGNQMMADGNLPATMGSINNMKPAVNMQTTTTTSMISTS
STETGSPLSFVTIPTPTSTKVSPTPFINRKPSTEAGKSMGKSIKMEPDADGKPIGSTMNN
TSASATFIKTEPNIKSESTTTTVATKAAASTKVPRPAKVFPPNELLQVLMPIVEKLFKQD
PESIPFRYPVDPDRLNIPDYYDIVKNPIDLTTIRKKLEVGEYQEPWEFVNDVWLMFHNAW
LYNRKTSRVYKYCTRLKEIFEQEIDPVMQELGYCCGRKLEFMPMTLCCYGKALCTIQTGA
VYYEYQNSSPKYGLLSDRYDFCEKCFNDIQGDLVSLSDEPGQGSNSVPKRDFMKKKNDVL
DPEPFVQCDECGRKLHTICVLYNPQIWPEGFVCDNCHRSRGSQRKPNRFMASKLPHNKLS
EHIEHRVNSYLKRHDTNNEAGYIHIRSVYSGEKTVEVKPGMKSKFVDSKEMPETFPYKAK
AFFAFEEIDGVDICFFGVHVQEYGSDAPIPNQRRVYLSYLDSVHFFRPRHLRTAVYHEIL
IGYFEYCKNLGYEFAHIWACPPSEGDDYVFHCHPPEQKIPKPKRLQEWYKKMLDKAIVDQ
VVLEYKDIYKQAKDDRLQAARELPYFEGDFWPNVLEESIKELEQEEEDRKQAEANEQAAA
EEASRHARLFKFTPLQSEQGPPNSKNDKKQKTKKATTKKAXSQRSAKKKIPQVANDLTDK
LYQIMEKHKEVFFVIRLQAADTISKLGSIADPDPLMPCELMDGRDSFLTLAREKHYEFSS
LRRTKWSTMAMLVELHVQGKFDYTCNNCKNRIEAPYHCTVCEDFDLCSTCWGQIGHEHKM
EQIGLALGVWSPGPGSGNLETGRTRAVQQCINSLVHACQCRNANCNLPACPRMKKIVTHT
KSCKRKTIGGCPICKQVIALCVYHAKICQEPKCAVPFCYNLKMRMKRQEKQHRRQESFLM
RRRMAIMSATSAQQGPHTPGADVNAAPATPKQEQPATPINNMVGPGTPGSQHGGPGTPNA
GGMGMAKQLPGTHLVSPHGGKGMPQPTMPQQQIRTNGPMGMMNQMSGGLASPMSMQHQIQ
MPQXQMNMISPSHPNVTTSYQGNVRFVAPVQGGFPRAVGQTMTQRPMMNPNTMQGQWGGQ
PQATNNFNLRQPSMANMANVASTNQQNIGIPRGVSPGPSMPVMKPGNSDKLRKLITKNPE
LAARVIQQTRQNRHQPHQNVLTVQQGGVGGNMGQNIVHTNAPMGQNIRMPNMNQQTGNMN
LQQMPQIQGQMNNVQHMQQRQRWLQQQQQQQQQQQHQGQPQQFQQPAPPYSQAVANQRMV
PGANTTTAMQIRLQQQQQQQQQQRIVRSQNMGMRMQNNMGQIMQTQMPQSMNSLNQPTMM
GQQGGQPHQVMMQQNVANQHQQMNMQGMQSGIVHQNVPPSRPPSQPMPQGRLPQMSPHAT
GNTRTTPLSGQVQMVNQPAGMMHGTMGGAPMEQHFNNNQPMMSGFTRTMGGMNNTMGHNM
VFADGSNQLSSGQDMMASSDGLEKFVTNNE
NT seq 7293 nt NT seq  +upstreamnt  +downstreamnt
atggctgatggttcaccaccttcgaaaagacaaaaaacctcagatatatttagtctggaa
aatgaactaccagaagaactcctctgtggtaccccaagtgggttaacaaatgggccaacg
gtgtccacagcggcacctccggtccccaccaccatcaataatggccaaacccaacccaca
cccccccaacctcttcccacccaagcaaacaccccttccatgcccgctcctgcttccaca
gcttcaatgcaaaacaaacaagtcacacagctactgcagacaggcagggggtcacccaag
tacccaggagggaccccatcccccgtaaacacaggcacaagtagcccccgaccgtcccgt
gcctcccaaccacaacaaagccccgcctctaactccttaatgtcgatgcaaagccccaca
ggaggctccaatattaacaacatcaaatcaccaatgaattcctcaatgtccgtatcgatc
tcacgatcaggcggcaacatgcgaaccactccctcccctcgtgtccaacccactttaaca
tcatccaacccaactatgataaatgcaagcttaccgaccacgggtgtctacaatagaaac
actataactcctcaacaaatgactcaacaaaacaatttgaaccaagttcaaaatgcaacc
atgcaacaacaacaacagcaacaacaattacaacaacaacaacaacaacaaccacaggtg
tttataaatggtccaatgcggcctcagatgtgcatggcaactgtaccaggtatgaacgta
atgaccagagctggccaaccacaaaatacaatgcagatgcaaaccatgcaagccactcct
ggtgtcaccaataacatgcagacgcgaatggcatttccacgtcccaacaacaatcgtatt
cttggaaataccacgatggttaacagcatggtgctcggtacccaaccccaacaacccaac
aatataccaatgaacagccaaactgtggtgggatccaacatgcagcccatgcatataata
aactcacatgatgggatgcccattcgacaaaacatgtaccagcaaaagaatatgaacatg
gggcaaccccagtttaatatcaacaacatgcaacagaaccaaatgacgaacgtaaccatg
cagcatccacaacaaaacccaaacccaatgatgcgaacgacacagatgaatcctatgcag
aatgtccagcaaacaggaggaatggttcaatcagggatgcagcaagttccacctgcaggt
aaccgcatgcaatcaagtggcggtggggttgtggaccccgagaaaaggaagttaatacaa
caacaactattcctactgttacatgcacaccgatgccttaaaaatgcatcaacgaatgag
ccaagcacatgtgcagtacctcactgccgaacgatgaaaaacgtacttcagcatatgaat
acttgtaccgaggggaagcaatgccaaattgcgcattgtgcgtcctctcgccaaatcatc
tcccattggaagcaatgtaaacgtgaagattgttctgtgtgtcttcctcttaaacaaaac
cagtccaactcaaacaacccgaacgcgatgcacgatgtgacgcataacaaaccagggatg
tttaacagccagataaacaccgcacttcaatctgtcccaacaccacaacagaaccaatcc
atgtttattggtcgtggcaatgtaggtgagccccaacaacaacctgggcaacaaataact
aagaactcccatactaccatggcccttgataaaaataaagtgcaagaagttcttggcctt
aacagctcatggaaacctgctccttctggtggagcattatctacccctagttccgtgcaa
aactctgaaataacttccacatctggtcaagaaatggcgggtgtaggacccatggcacaa
ccacgtactgtacaccaatggcattcacaagtgaaagaagaacttcgaaattatttggtg
cagaagttagttcaaaatattttccccaccccggataaaatttcaatgacggatgttcgg
atgattaaacttctttcattcgctcgtaaagtagaggggtcgatgtatgaacaagccagc
tcaagggaggagtattatcaccttcttgccgaaaagatttataaaatacaaaaagaactg
gaagaaaaaaggcaaaagaagccgctaggtgccatgaatggacctaccagtgttagccaa
caacaacaacaacaacaacaacagcaacagcaacagcaacacagattggctggtggtttc
atgaacaaagctcctggtggtccaagccaactacggatggtgaaccaagttaacaatgtt
aactatatggatcaatctcaagtcaacccagccagtaatatcaacatgccaactaatggt
gttgtaaacaacaataatccgaatactccactgtccggaacaatacgccagtttgccctc
gcaatgaaggaaattgattcttcgaatgcaaatcgccctcctatgacatcaccaccatta
tccaacagcccaatgaccatcaccaaccaacaatttgggactacatcattctcaaaccaa
attcaaatccctggaatgaacaaccaatgtcctcctcttaactcctccgatcccaacatc
caacctcccaacaacaactccatgatgaatgaaacaacgcaagataattcattcatccaa
cgcagccaaccagggatgaacaacaacttccaaaactccttgcccaacgttacaacacaa
cagcaaggaaaccaaatgatggctgacggaaacctaccagctactatggggtcaataaac
aacatgaaacctgcagtaaacatgcagactactaccactacctctatgataagcaccagt
tcaactgaaactgggtccccgctatcatttgtaacaattcccacgcccactagcaccaaa
gtctcaccaactccattcataaataggaagccatccactgaagcagggaaatccatggga
aaatccataaagatggaaccagacgctgatggtaaaccaataggaagtacaatgaacaac
acatcagcatctgccacttttattaaaacagaaccaaacatcaaaagtgaatcaacgaca
accactgttgcaactaaagctgctgcttctaccaaagttccacgacctgcaaaagtgttt
cccccgaacgaattactccaagtcttaatgccgatagttgagaaattgttcaagcaagac
ccagaatccattcctttccgttatccggtggatccagatagactcaatatacccgattat
tatgacatcgtaaagaatcctattgatctcacaactattcgtaaaaagcttgaagttgga
gaataccaggagccatgggagtttgtgaacgatgtgtggctgatgtttcacaatgcttgg
ttgtataatcgcaaaacatcaagggtgtataaatactgcacgaggttaaaggagatcttt
gaacaagagatcgatccagttatgcaagagcttggttactgttgtggtagaaagcttgag
tttatgccaatgacgttgtgttgttatgggaaagcattgtgtacgatacagactggtgct
gtatattatgaatatcagaacagttccccaaaatatggtttgttatcggatcgttacgat
ttctgtgagaaatgtttcaacgacatccagggtgacctcgtctcactaagtgatgaacct
ggccaaggatcaaattcggtgccaaaacgagattttatgaagaagaaaaatgacgttctt
gatcccgaaccgtttgtccaatgtgatgaatgcggaaggaagctgcacaccatatgtgtg
ttatataatccacaaatatggccggaagggtttgtgtgtgacaattgtcaccggagccgt
ggcagccagcggaagccgaacaggttcatggcaagcaagttgccacacaacaaacttagt
gagcacattgaacacagagtgaacagctatctcaagcgacatgatacaaataacgaagcc
ggttatattcacattcgttcagtctacagtggagagaaaacggttgaagtaaaacctggg
atgaagtcaaagttcgttgattcaaaagaaatgccggagactttcccctacaaggccaaa
gctttctttgcgtttgaggaaatagacggggtcgatatctgtttctttggtgtccatgtg
caggaatatggttctgacgctccaataccaaaccaaagacgagtgtatctatcgtatctt
gactcagttcatttcttccgtccacgacacctaagaacggctgtctatcatgagattctg
atcggatattttgaatactgcaagaatttgggatacgagttcgcccatatttgggcttgt
cctccgagcgaaggagatgattacgtcttccattgccatcctccggagcaaaagattcca
aaaccaaagcgattacaagaatggtacaagaaaatgctggacaaagcaattgttgaccag
gtagtgcttgaatacaaggatatttataaacaagccaaggacgatcgcttacaagctgcg
agggaactcccgtatttcgagggcgacttctggcccaatgtattagaggagagtatcaag
gagttagaacaggaggaggaagatcggaaacaggcggaggcgaatgaacaagctgctgct
gaagaggcctcacgccatgcacgattattcaagttcaccccccttcaatccgaacagggc
cccccaaactcgaagaacgataaaaaacagaagacaaagaaagcaaccacaaagaaagct
nnttcacaaagaagcgcgaaaaagaaaatcccacaagtggcgaacgatttgaccgataaa
ctttatcaaatcatggaaaaacataaagaagttttctttgttatccgtttacaagctgcc
gacacgataagtaagcttggttcgatagccgaccccgatccgctgatgccgtgcgagttg
atggacgggagagattcattcttaacactggctcgcgagaaacattatgaattctcatcg
ctacggaggacaaagtggtcaacaatggctatgttggtggaactccatgttcaagggaag
ttcgattatacttgtaataattgtaagaacaggatagaagctccatatcactgcacagtc
tgcgaggactttgatctatgtagtacgtgttggggtcaaatcgggcacgagcataagatg
gaacaaattggtctcgcattgggtgtttggtcccctggccccgggagtggtaacttggaa
acggggcgtacacgcgctgtgcaacaatgcattaactcccttgtccatgcttgccaatgt
agaaatgctaactgtaatttacctgcttgcccacggatgaaaaagattgtgacacacacg
aagagctgtaagaggaaaaccattggaggttgtccgatttgtaaacaagttattgctctg
tgcgtttaccacgccaagatttgccaggagcctaaatgtgccgttccgttctgctacaac
ctcaagatgcgaatgaagagacaggagaagcaacatcggcgacaggagtccttccttatg
aggaggaggatggccatcatgtcggcaacatccgcacaacaaggaccccacacaccgggt
gcggatgttaacgcagcccccgctacaccaaagcaagaacaacctgcaacccctattaat
aacatggtgggtcctggaacccctggctcgcagcatgggggacctggaacccccaacgca
gggggaatgggaatggctaagcagttacctggtacccatttagtctcgccccatgggggt
aaaggcatgccgcaacccactatgccccaacagcagattagaacgaatggtccaatgggc
atgatgaaccagatgtccggtggtttagcttcaccaatgtcgatgcaacaccagatacag
atgccacaaaancagatgaacatgatcagtccgtcgcatcccaacgtaacaacttcctac
caaggcaatgttaggtttgtcgcccctgtgcaagggggtttccctcgcgcagtgggtcaa
acgatgacccaacgcccaatgatgaaccctaacaccatgcaggggcagtggggcggccaa
ccgcaagccactaacaactttaacttgcgtcaaccatccatggcgaacatggcaaacgta
gcttctaccaaccagcagaatatcgggattccccgtggggtaagtcccggtcccagcatg
ccagttatgaaaccggggaattccgacaaacttcggaaattaataacgaagaacccggaa
cttgctgcgagagtgattcaacaaactcgtcaaaaccgacaccaaccccaccagaatgta
cttactgtacagcagggtggagttggggggaatatgggtcaaaacatcgtccacacgaac
gcaccgatgggacaaaacatccggatgccgaacatgaatcaacaaactgggaacatgaac
cttcaacaaatgccacagatccaaggtcaaatgaacaacgtgcaacatatgcaacaacga
caacggtggttacaacaacaacaacaacagcaacaacaacaacaacatcaaggccaacca
caacaattccaacaaccagcgcccccgtattcacaggctgttgcgaaccaacgcatggtg
ccgggtgccaacacaacaactgccatgcaaataaggttacaacaacaacaacaacagcaa
caacaacagaggatagttagaagccagaatatgggaatgcgaatgcagaataacatgggg
cagataatgcaaacacagatgccacagagtatgaacagtttaaaccaacctaccatgatg
ggacaacagggcggtcaacctcaccaagttatgatgcaacaaaatgtggcaaaccaacac
cagcagatgaacatgcagggcatgcagagtggcatcgtgcaccagaacgtgccgccgtcg
cggcctccctcacaacccatgccacagggcaggttgccacagatgtcgccacatgccacg
ggtaatacaaggacaacccctctttcaggccaggtgcaaatggtgaaccaacctgctggt
atgatgcacggaaccatgggaggtgcacctatggaacaacacttcaacaacaaccagcct
atgatgtctggcttcactaggactatgggtggcatgaacaacacgatgggtcataatatg
gtgtttgctgatggcagcaaccagctttcatcagggcaagacatgatggcaagcagtgat
gggttggagaagtttgttacgaataatgaataa

DBGET integrated database retrieval system