KEGG   Ciona intestinalis (sea squirt): 778660Help
Entry
778660            CDS       T01056                                 

Gene name
jnk
Definition
c-jun N-terminal kinase
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:cin04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:cin04310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
14
AA seq 439 aa AA seqDB search
MGQADEGMSNGKNKGANAPTGAATTGKDTANTEFYTVQVSDSVFTVLKRYQSLKPIGSGA
QGMVCAAHDTVLGQHVAIKKLSRPFQNPTHAKRAYRELVLMRAVNHKNIIGLLNVFSPQS
SYEDFSHVYLVMELMDASLCQVIQMDLDHERLSYLLYQLLCGIKHLHSAGIIHRDLKPSN
IVVRSDCTLKILDFGLARTAGGSFMMTPYVVTRYYRAPEVILGMGYQEVVDIWSVGCIFG
EMIRGQVLFPGNDHIDQWNKITEQLGTPSEDFINKLQPTVRNYVLNRPFQRGHPIHRLFP
DSLFPADSESNGRLRSSQARDLLAKMLVVDPIGRITVDDALQHPYIKIWYDPSEVEGPGP
KVDGGSIDEVDYSVEKWKEVIWTEVKLWDTVDTTVPNPVIPLSTAVPDQPAEKLEPEKVE
SNPDVPAATAQVVKAETEG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggggcaagcagatgagggcatgagcaacggtaaaaataaaggtgctaatgcacctact
ggtgctgctacgactggcaaagatacagcaaatacagagttctacactgtacaagtatct
gattctgtctttactgtgcttaagagatatcagagcctgaaaccaattggttctggtgca
caaggaatggtatgtgccgcccatgatacagtacttggccaacatgtagccataaagaaa
ctcagtcgtccgttccaaaatccgacacatgcgaagcgtgcctaccgcgagcttgtcctt
atgcgcgctgtcaaccacaaaaatatcatcggtttactgaacgttttttcaccccaatct
agttatgaagatttttcccatgtgtatcttgtcatggaacttatggatgctagtttatgc
caggtgattcaaatggatcttgaccacgaaagactctcctatcttctctaccagttactt
tgtggcattaaacacttgcattctgctggtatcattcacagggacttaaaaccatccaac
attgtagtacggtcggactgcacacttaaaattcttgactttggtttggcaagaactgca
ggaggttcttttatgatgacgccgtatgtggtgacacgatattacagagcaccagaagtg
attttaggaatggggtatcaagaagtagtggacatatggtcagtgggatgtatctttggt
gaaatgattagaggtcaggtcctttttcctggaaatgatcacatagatcaatggaataag
ataacagaacaattaggaactccatcagaggactttatcaacaaactgcagccaacagtg
aggaattatgttttgaatcggccattccaaagaggacacccaattcatcgcttgttccct
gatagtctcttcccagctgactccgagagcaatggaagactccggtcaagtcaggcacgc
gatcttcttgctaagatgttggtagttgacccaattggaagaattactgttgatgatgca
ctgcaacacccatatattaaaatctggtacgatcccagcgaggtagaaggcccaggtcca
aaagtcgacggcggatcaatagacgaggtcgattactcggttgaaaaatggaaagaagta
atttggacagaagtaaaactatgggacacagtggacacaactgtcccgaacccggttata
ccgctctcgacagctgtaccagatcaacctgctgaaaaactcgaacccgagaaggtagag
agtaacccagacgtgcctgctgctactgcacaggttgtgaaagcagaaacggaaggataa

DBGET integrated database retrieval system