KEGG   Ciona intestinalis (sea squirt): 778660Help
Entry
778660            CDS       T01056                                 

Gene name
jnk
Definition
c-jun N-terminal kinase
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    778660 (jnk)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    778660 (jnk)
   04068 FoxO signaling pathway
    778660 (jnk)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     778660 (jnk)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   778660 (jnk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
14
AA seq 439 aa AA seqDB search
MGQADEGMSNGKNKGANAPTGAATTGKDTANTEFYTVQVSDSVFTVLKRYQSLKPIGSGA
QGMVCAAHDTVLGQHVAIKKLSRPFQNPTHAKRAYRELVLMRAVNHKNIIGLLNVFSPQS
SYEDFSHVYLVMELMDASLCQVIQMDLDHERLSYLLYQLLCGIKHLHSAGIIHRDLKPSN
IVVRSDCTLKILDFGLARTAGGSFMMTPYVVTRYYRAPEVILGMGYQEVVDIWSVGCIFG
EMIRGQVLFPGNDHIDQWNKITEQLGTPSEDFINKLQPTVRNYVLNRPFQRGHPIHRLFP
DSLFPADSESNGRLRSSQARDLLAKMLVVDPIGRITVDDALQHPYIKIWYDPSEVEGPGP
KVDGGSIDEVDYSVEKWKEVIWTEVKLWDTVDTTVPNPVIPLSTAVPDQPAEKLEPEKVE
SNPDVPAATAQVVKAETEG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggggcaagcagatgagggcatgagcaacggtaaaaataaaggtgctaatgcacctact
ggtgctgctacgactggcaaagatacagcaaatacagagttctacactgtacaagtatct
gattctgtctttactgtgcttaagagatatcagagcctgaaaccaattggttctggtgca
caaggaatggtatgtgccgcccatgatacagtacttggccaacatgtagccataaagaaa
ctcagtcgtccgttccaaaatccgacacatgcgaagcgtgcctaccgcgagcttgtcctt
atgcgcgctgtcaaccacaaaaatatcatcggtttactgaacgttttttcaccccaatct
agttatgaagatttttcccatgtgtatcttgtcatggaacttatggatgctagtttatgc
caggtgattcaaatggatcttgaccacgaaagactctcctatcttctctaccagttactt
tgtggcattaaacacttgcattctgctggtatcattcacagggacttaaaaccatccaac
attgtagtacggtcggactgcacacttaaaattcttgactttggtttggcaagaactgca
ggaggttcttttatgatgacgccgtatgtggtgacacgatattacagagcaccagaagtg
attttaggaatggggtatcaagaagtagtggacatatggtcagtgggatgtatctttggt
gaaatgattagaggtcaggtcctttttcctggaaatgatcacatagatcaatggaataag
ataacagaacaattaggaactccatcagaggactttatcaacaaactgcagccaacagtg
aggaattatgttttgaatcggccattccaaagaggacacccaattcatcgcttgttccct
gatagtctcttcccagctgactccgagagcaatggaagactccggtcaagtcaggcacgc
gatcttcttgctaagatgttggtagttgacccaattggaagaattactgttgatgatgca
ctgcaacacccatatattaaaatctggtacgatcccagcgaggtagaaggcccaggtcca
aaagtcgacggcggatcaatagacgaggtcgattactcggttgaaaaatggaaagaagta
atttggacagaagtaaaactatgggacacagtggacacaactgtcccgaacccggttata
ccgctctcgacagctgtaccagatcaacctgctgaaaaactcgaacccgagaaggtagag
agtaacccagacgtgcctgctgctactgcacaggttgtgaaagcagaaacggaaggataa

DBGET integrated database retrieval system