KEGG   Ciona intestinalis (sea squirt): 778672Help
Entry
778672            CDS       T01056                                 

Gene name
mapkk4
Definition
mitogen-activated protein kinase kinase
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 475 aa AA seqDB search
MSNNNPTRSRPQGFFNMNPPSNTQGHQAMEDDLPPGSTPTQFSHARPNIPSMSLGQFNPY
SGGGVIAPQRKTTASRSKSNQSLNFAFAPAQSASSPAIDNLSFRGASPISTSYSTDSGRF
VSSSSSAASIGTPSRITPEHIIRTYSEESVGKLKIEPYNEAFDFVASDLKDLGEIGRGAF
GAVNRMMHRDSSTEMAVKRIRSTVDEKEQKQLLMDLDVVMRSNDCPYIVKFYGALFWEGD
CWICMELMSTSLDKFYRFVYLRERKRIPEEILGKIAMATVKALHYLKEKLQIIHRDVKPS
NILIDRGGNIKLCDFGISGHLVNSIARTRDAGCRPYMAPERIDTSRSRNGYDVRSDVWSL
GITLIELATGKFPYPKWNNVFDQLTQVVKGDPPKLRNDLANGLTFSPGFTDFINMLTIAD
SEQRPKYGRLLATPYMQQIERQHVYVANYFCDVLNRMTDADFHTGAVGDEPFRDS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataacaatcccacacgttctcgcccgcagggattttttaatatgaacccaccc
agtaatacccaggggcatcaagcaatggaagatgatttaccacctggaagcacaccaact
cagttttctcacgcgcgtcctaacattccatcaatgtcgcttggacagttcaacccttac
agcggaggtggggtgattgcaccgcagcgtaaaaccaccgccagccgctcaaaatcaaac
caatcactaaattttgcttttgctcctgcacaatctgcctcttccccagcaatagacaac
ctcagtttcagaggagcatctccaatttcaacatcctattccacggactcgggaagattt
gtgtcttcctcttcctctgcagcaagcattggaacaccatccaggatcaccccagagcac
atcatcaggacatacagtgaagagagcgtggggaaacttaaaatcgaaccctataatgag
gcgtttgactttgttgcgtctgacctaaaagacctgggtgaaattggccgtggtgcgttt
ggtgctgtcaatcgtatgatgcatcgagatagttcaaccgagatggctgttaaaaggatt
cgttcaactgttgatgagaaagaacaaaagcagcttcttatggaccttgatgtggtaatg
agaagcaatgactgcccatatattgtcaaattctatggtgcattattctgggagggagac
tgctggatatgtatggaactcatgtccacatcactagataaattttatcgttttgtttac
ctgcgtgagagaaaacgcatcccagaggaaatacttggaaagattgccatggcaacagta
aaggctctgcattatttgaaagagaaacttcagatcatccatcgtgatgtaaaaccttcc
aacatcctcattgacagaggtggaaacattaaattatgtgactttggaataagcggacac
ctggtcaactccatagcaagaaccagggatgcagggtgtagaccttacatggcaccagaa
agaattgatacttctcgctccagaaacggttacgatgtacgttctgatgtttggagcctg
ggtataactctaatagagcttgccacaggaaagttcccatacccaaagtggaacaatgtt
tttgaccagctcactcaggttgtaaaaggcgatcctccgaaattacgaaatgatcttgcc
aatggactcacatttagccctggcttcactgacttcattaacatgcttaccattgctgat
tctgaacagcgaccaaaatatggccgtcttcttgcaaccccttatatgcagcaaattgag
aggcagcatgtatacgtggcaaattacttttgcgatgttcttaaccggatgactgatgcg
gacttccacaccggagctgttggtgatgaacctttccgggactcctga

DBGET integrated database retrieval system