KEGG   Ciona intestinalis (sea squirt): 778746Help
Entry
778746            CDS       T01056                                 

Gene name
rxr
Definition
nuclear receptor
Orthology
K08524  
retinoid X receptor alpha
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 507 aa AA seqDB search
MSLPTTGNGLSSSQSSAPAMFTQSNQRVLQPPALSIMGFRGMPPMPHHPQFVMNSQGGMI
QLPHGLMVPGSEAPTVPTSNPAMASRFSADRLPVGGINGSISPQQIPDSSSGSQAGGNPM
SFGNITVKQEMGQGSMVPLQYPQLSSTENMGTNMFSVSSSGVPLSKHICAVCGDRASGKH
YGVYSCEGCKGFFKRTVRKYLTYTCRDDKDCIIDKRQRNRCQYCRYQKCITMGMKKEAVQ
EERQKNREQDECHGDGGHDDMPVDKILQAELASDPKMEELINMQEPIDTSVCKAADHQLF
TLVEWAKRVPMFGTLPLDDQVTLLRAGWNELLIASFSHRSIEIPDGIILASGLRVYRQSA
HSAGVGAIFDRVLTELIAKMRDMSMDRTELGCLRAIVLFNPDAKDLTDPAYIETLREKVY
ASLEVYCKSKYPDQAGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGNTPIDQFLMDKLAP
HDTEATSSPSTQATQNNDINLAGVANL
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgccaactacggggaatggtttgtcatcttcccaatccagcgcaccggcaatg
tttacccagagtaaccaacgtgtcttacaacctcctgctttatctattatggggttcagg
gggatgcccccaatgccccaccacccccaattcgtcatgaactcacaaggaggaatgatc
cagttaccccatgggttaatggtccccggttctgaggcccctactgttccaacatcaaat
ccagccatggcgtcccgattttcagcagatagattgccggtaggtggaatcaatggttct
atttcaccccaacagattccagacagcagttcaggaagtcaagctggtgggaacccaatg
tcttttggaaacataactgtcaaacaagaaatgggtcaagggtctatggttccactccag
tacccacaactttcatcaacagaaaacatgggaacaaatatgttttctgtgtccagtagt
ggagttccattgtcaaaacatatctgtgcagtgtgtggagatcgcgcatctgggaagcat
tatggagtatatagctgtgaagggtgcaaaggattttttaaaagaactgttcgaaagtat
ttgacgtacacttgtagagatgacaaggattgtattattgataagcggcaaagaaaccgc
tgtcagtattgtagataccagaagtgtataacgatgggcatgaaaaaagaagctgtccag
gaggaacgacagaagaatcgtgagcaagatgagtgtcatggtgatggaggacatgatgac
atgcctgtagataaaatacttcaagcagaattggcatcagatccaaaaatggaggaacta
ataaacatgcaggagccgatagacacaagcgtgtgcaaagccgctgatcatcaactgttt
acattggtagagtgggccaagcgagtgcctatgtttggtacattgccattggatgaccag
gtcacgctactgagagcaggatggaatgaacttctgatcgcttcattcagtcatcggagc
atcgagatacctgatggcatcattcttgcttccggactccgagtttatcggcagagtgct
cactctgcgggggtgggagcaatatttgatcgagttttgacagaattaattgctaagatg
agagacatgtcaatggatagaacggagcttggatgtcttagagcgattgttctgtttaac
ccagatgcaaaagacttgacagatccagcttacattgaaacattaagagaaaaggtttat
gcatcgctggaggtttattgcaaatctaaatatcctgaccaagctggaagatttgcaaag
cttcttcttcgactcccagccctgcgctctatcggcctcaagtgtcttgagcatcttttc
tttttcaagttgatcggcaacactccaattgatcagttcctcatggataagctggctccc
catgacacggaagctacaagctccccatccacacaagccacacagaacaatgacattaac
ctcgctggcgtcgccaacctgtga

DBGET integrated database retrieval system