KEGG   Ciona intestinalis (sea squirt): 778778Help
Entry
778778            CDS       T01056                                 

Gene name
tgfbr-iib
Definition
transforming growth factor beta receptor
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    778778 (tgfbr-iib)
   04068 FoxO signaling pathway
    778778 (tgfbr-iib)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    778778 (tgfbr-iib)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     778778 (tgfbr-iib)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   778778 (tgfbr-iib)
Enzyme-linked receptors [BR:cin01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   778778 (tgfbr-iib)
Cytokine receptors [BR:cin04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   778778 (tgfbr-iib)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 567 aa AA seqDB search
MKCLMLISLLSYLHTGSSIHCRQCSAEIDANDCNSTSCTIPCPTVDCSCLGLCYTNVILN
FSGKHSVQAACIQQLCPTRASYLNLYTKRQIEGYCDVSKGVVTCECASDDCNHMISFEPI
TIDDEDIIIEDKYDLSSIIVGVLVGFLLLCLLVAVVWYSVGRYRRLKDEEFESKLTSGSR
LSSDDASLIDGWDDSGKHSYSAYRYSSSVATQYSRGSRGNVLNHNDQHLPIELQKIIGKG
RFAEVWKANLQQDASPPQVVSVKVFRLHNYGAWRQEKDMLTESWMRHENIIEFYASEQHT
VRGRLQYWLITSYYQEKSLADFLGSNILDWDQFCDMATSIAKGLSYLHAERDDVGRPKIP
IAHRDVKSCNILVKDGRRECVLADFGLSLKLDPKLSRDELANAGQVGTSRYMAPELLERL
VNLTDIEMFKRVDVYAMALVLWEMANRCETSEGMASPYKPPFGDKINDRPTKDQMLLLVC
KERQLPSIPEKWKKHQGLSEFVDTILNETWEYDAEARITASCVLERFKVLRHHGDVIGSD
GSDVEDKIRVKAKNESNRISEVISTVV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaatgttaatatccttgctgtcatatttacacaccggttcatccatacat
tgtcggcaatgcagcgctgaaatagatgccaacgattgcaattcaacatcatgtacaata
ccttgtcccaccgttgattgtagctgccttggtctgtgttacaccaacgttattctaaac
ttctctggcaaacactccgtacaggcggcttgtatacaacagttatgtccaacaagagcc
agctatctaaacctctacactaagcgtcagatagaggggtattgtgacgtaagcaagggt
gttgtgacgtgtgaatgtgcctcagatgactgcaatcacatgatatcatttgaaccaatc
acaatcgatgacgaagatataataattgaagacaaatacgatttgtcgtccatcatcgtt
ggtgtcttggtaggatttctcctcctttgccttcttgtggctgtggtgtggtacagtgta
ggccggtatagaaggttaaaagatgaagaatttgaaagtaaattgacatccgggagcaga
ctatcctccgatgatgcaagtcttattgatggttgggatgatagtgggaaacatagttac
tcagcttacagatattcatcgagcgttgctacccagtatagtcgtgggtcacgtggaaac
gtactcaaccataacgaccaacatttaccgatcgaacttcaaaaaataatcggcaaagga
agattcgctgaggtttggaaagcaaatctacaacaagatgcttctcctcctcaagttgtt
tcagtgaaagtatttcgtcttcacaattatggggcgtggagacaagagaaagacatgcta
actgaaagttggatgaggcacgaaaacatcattgaattttatgcttctgagcaacacaca
gtgcgaggtcggttgcagtattggctcataacttcttactatcaagagaaaagtttagct
gactttttgggctccaatattcttgactgggatcagttttgtgacatggcaacctcaata
gctaaagggttatcatacctgcatgcggagagagatgacgtgggtcgccccaagatacca
atcgcccacagagacgtcaaaagttgtaacatccttgtgaaagatggcaggagagaatgc
gtgttggctgacttcgggctttcactcaagttggacccgaagttgagtcgtgatgaactt
gcaaacgctggccaggttggaacatcaaggtacatggctcccgagttattggaaagactg
gttaacctcacagatattgagatgtttaagcgagttgacgtttacgcgatggctttagtt
ttgtgggagatggcgaatcgttgtgaaacttcagaaggcatggcgtctccgtataaacca
ccgtttggagacaaaataaacgaccgacccaccaaagatcaaatgctgcttcttgtgtgc
aaagagcgccaactaccgagtattccggagaaatggaaaaagcaccagggtctctctgaa
ttcgttgacactatactgaacgaaacatgggaatatgacgctgaagctagaatcaccgct
agttgtgtgttggagagatttaaagtattacgtcatcatggtgacgtcatcggctctgac
ggcagtgacgtcgaggataagattcgtgtgaaagccaagaatgaatcgaacagaatatct
gaagttatttcaacagttgtgtga

DBGET integrated database retrieval system