KEGG   Ciona intestinalis (sea squirt): 778778Help
Entry
778778            CDS       T01056                                 

Gene name
tgfbr-iib
Definition
transforming growth factor beta receptor
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:cin04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:cin04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 567 aa AA seqDB search
MKCLMLISLLSYLHTGSSIHCRQCSAEIDANDCNSTSCTIPCPTVDCSCLGLCYTNVILN
FSGKHSVQAACIQQLCPTRASYLNLYTKRQIEGYCDVSKGVVTCECASDDCNHMISFEPI
TIDDEDIIIEDKYDLSSIIVGVLVGFLLLCLLVAVVWYSVGRYRRLKDEEFESKLTSGSR
LSSDDASLIDGWDDSGKHSYSAYRYSSSVATQYSRGSRGNVLNHNDQHLPIELQKIIGKG
RFAEVWKANLQQDASPPQVVSVKVFRLHNYGAWRQEKDMLTESWMRHENIIEFYASEQHT
VRGRLQYWLITSYYQEKSLADFLGSNILDWDQFCDMATSIAKGLSYLHAERDDVGRPKIP
IAHRDVKSCNILVKDGRRECVLADFGLSLKLDPKLSRDELANAGQVGTSRYMAPELLERL
VNLTDIEMFKRVDVYAMALVLWEMANRCETSEGMASPYKPPFGDKINDRPTKDQMLLLVC
KERQLPSIPEKWKKHQGLSEFVDTILNETWEYDAEARITASCVLERFKVLRHHGDVIGSD
GSDVEDKIRVKAKNESNRISEVISTVV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaatgttaatatccttgctgtcatatttacacaccggttcatccatacat
tgtcggcaatgcagcgctgaaatagatgccaacgattgcaattcaacatcatgtacaata
ccttgtcccaccgttgattgtagctgccttggtctgtgttacaccaacgttattctaaac
ttctctggcaaacactccgtacaggcggcttgtatacaacagttatgtccaacaagagcc
agctatctaaacctctacactaagcgtcagatagaggggtattgtgacgtaagcaagggt
gttgtgacgtgtgaatgtgcctcagatgactgcaatcacatgatatcatttgaaccaatc
acaatcgatgacgaagatataataattgaagacaaatacgatttgtcgtccatcatcgtt
ggtgtcttggtaggatttctcctcctttgccttcttgtggctgtggtgtggtacagtgta
ggccggtatagaaggttaaaagatgaagaatttgaaagtaaattgacatccgggagcaga
ctatcctccgatgatgcaagtcttattgatggttgggatgatagtgggaaacatagttac
tcagcttacagatattcatcgagcgttgctacccagtatagtcgtgggtcacgtggaaac
gtactcaaccataacgaccaacatttaccgatcgaacttcaaaaaataatcggcaaagga
agattcgctgaggtttggaaagcaaatctacaacaagatgcttctcctcctcaagttgtt
tcagtgaaagtatttcgtcttcacaattatggggcgtggagacaagagaaagacatgcta
actgaaagttggatgaggcacgaaaacatcattgaattttatgcttctgagcaacacaca
gtgcgaggtcggttgcagtattggctcataacttcttactatcaagagaaaagtttagct
gactttttgggctccaatattcttgactgggatcagttttgtgacatggcaacctcaata
gctaaagggttatcatacctgcatgcggagagagatgacgtgggtcgccccaagatacca
atcgcccacagagacgtcaaaagttgtaacatccttgtgaaagatggcaggagagaatgc
gtgttggctgacttcgggctttcactcaagttggacccgaagttgagtcgtgatgaactt
gcaaacgctggccaggttggaacatcaaggtacatggctcccgagttattggaaagactg
gttaacctcacagatattgagatgtttaagcgagttgacgtttacgcgatggctttagtt
ttgtgggagatggcgaatcgttgtgaaacttcagaaggcatggcgtctccgtataaacca
ccgtttggagacaaaataaacgaccgacccaccaaagatcaaatgctgcttcttgtgtgc
aaagagcgccaactaccgagtattccggagaaatggaaaaagcaccagggtctctctgaa
ttcgttgacactatactgaacgaaacatgggaatatgacgctgaagctagaatcaccgct
agttgtgtgttggagagatttaaagtattacgtcatcatggtgacgtcatcggctctgac
ggcagtgacgtcgaggataagattcgtgtgaaagccaagaatgaatcgaacagaatatct
gaagttatttcaacagttgtgtga

DBGET integrated database retrieval system