KEGG   Ciona intestinalis (sea squirt): 778841Help
Entry
778841            CDS       T01056                                 

Gene name
bco
Definition
beta-carotene-15,15'-monooxygenase
Orthology
K00515  
beta-carotene 15,15'-monooxygenase [EC:1.14.99.36]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Retinol metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:cin00830]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 524 aa AA seqDB search
MDFPVSAFPHLTALATTKNIEYAEAVQGKVQGEVPNWLNGSWYRNGPGVVHFREESVKHW
FDGMALARKFCIEDGKVSYMSRLVDGESLQKNTAAGRVVVAEFGTTTHSEGFLGRVKSAL
TMPEFTDNCLINFMNLGDHLFAITESNFIRQIDPVTLDTKDKVDLAKHLPINIMSSHPLV
DGEGNVYTFSSSIFNMGRTKYNLLKFTAAAPGTPLETILSQSESICSIDSSWRVSPSYHH
SFAMSEKYAVFVEMPLKIDIPKMAVAHLRHMCYSDCIEVLEDTKTRIYLVNKETGKQHPI
TFLCDPLIVYHHVNAYDDGDHVVLDLSCYKKNSFYDKFTMSNLEKTPQEFSKLFDSDEQA
VKAMRIVLPLANDSKTTGNLVSVANTSCTAEFQGNNIFCTSEMLSVGTECAVINNKYIGK
KYKYFYSPGGLKLPPGEMLTKIDVETKQRVQTWQEKGCWASQPVFVAKPGATQEDEGILM
SSVVNENGNPFLLMLDAKSFTEVARIHFDANIPPDVHGVFVPKA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggatttcccagtttctgcattccctcacttgactgcgcttgctacaaccaaaaacatc
gaatacgcagaggcggtacaaggaaaagttcaaggtgaggttccaaattggctgaatggt
agctggtaccgtaacggaccgggagtcgtccatttccgagaggagagcgtcaagcattgg
ttcgatggcatggcgcttgcaagaaagttctgcattgaagatggtaaggtcagttacatg
agcagactggttgacggcgagagtttgcagaagaacacagctgcagggagggtcgtggtg
gccgaatttggaactactactcactctgaaggatttcttggaagagtaaagagtgcgtta
acaatgccagaattcaccgataattgtctcattaacttcatgaatctcggtgatcatctg
ttcgccatcactgaaagcaacttcattcgtcagatcgatccggtgacccttgatacaaag
gacaaggttgatcttgcgaaacaccttcctatcaacataatgtcatctcatccccttgtg
gatggtgaaggcaacgtctacactttctccagctccatatttaacatgggaagaaccaaa
tacaacttgctcaagttcactgcagctgcaccgggaactccgttggaaacaattctatcg
cagtcggaatctatttgtagcatcgattcgtcatggagagtcagcccatcatatcatcat
agctttgctatgtcagagaaatatgccgtcttcgttgaaatgccgctcaaaattgatatt
cccaaaatggcggtcgcacacttgcgccacatgtgctacagtgattgcattgaggtgtta
gaagataccaagactcgcatttatttggtgaacaaggagaccggcaagcaacatccaatc
accttcttatgtgacccgcttatcgtgtatcatcatgtgaatgcatacgatgatggggac
catgtggtattggacctcagctgttacaagaaaaacagcttctacgacaagttcacgatg
tccaatttggaaaagactccgcaagagttctctaagttatttgacagcgatgaacaagct
gttaaagcgatgaggattgttcttccattggctaatgattccaaaacgacagggaatctt
gtttcggtggcaaacacctcgtgcacagccgagttccagggcaataacatcttctgtaca
agcgagatgctgagtgtgggaaccgagtgtgctgttatcaacaataaatacattggcaag
aagtacaagtatttctacagccccggtggattaaaactcccaccaggagaaatgttgaca
aagattgacgtggaaacaaagcagagagtgcaaacttggcaggagaaaggttgttgggcg
tctcaacctgtcttcgtagcgaaacccggagcaacacaggaagacgaaggtatccttatg
tcatctgtggtaaatgaaaacggaaacccatttttgttgatgctggacgccaagagcttt
accgaagtcgcccgaatccactttgacgctaatatcccaccggatgttcacggagtattt
gtccctaaagcatga

DBGET integrated database retrieval system