KEGG   Ciona intestinalis (sea squirt): 778875Help
Entry
778875            CDS       T01056                                 

Gene name
zf(c2hc)-2
Definition
zinc finger protein
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     778875 (zf(c2hc)-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 512 aa AA seqDB search
MKTRGKSDNSNAGSDSKSRDINEEVKTKTKCVTPKKSNPLGMTEHEMLLALDETGGRLRK
RKFAQSYHVDMKQCPVSGCDSRGHLMGRFERHFTLAACPIYHNLTPERCRANHEANERLR
KDQAEDAGRDQVIVHHNTRNQTEVEATPSQAKYRKRVQRSREQHSSSEHRKSDPEHQAEH
GVKEPLLNHVASEYDLNLFRQAQALASEGLEHELERLHESGLLSQDGSNPDRRIKVIEIG
RYEMDTWYSSPYPEEYVQLPKLYICEFCLKYMKSSTILRRHMAKCVWRHPPGDEIYRKGT
ISVFEVDGKKNKIYSQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADLTGCHMVGYFSKE
KNSFLNYNVSCILTMPQHMRKGYGKMMIDFSYLLSRKEGKTGSPERPLSDLGLLSYRSYW
TDIIISYLSKLDAAADLVIRDISQETAVHPADIVSTLQALQMLKYWKGKHIILKKQDIIE
DWLRKQTKKPAEFSSRAIDSKCLKWSPTRQKE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcggcaaatccgacaattcaaacgcggggtccgattcaaaaagcagggat
ataaacgaggaggtgaaaacgaaaacaaaatgtgtcacgccgaagaaatcgaatcctctc
gggatgacagagcatgagatgttgttggcgctcgatgaaactggtgggaggctacgtaaa
cggaagttcgctcagtcgtaccacgtcgatatgaaacaatgtccggtgtcagggtgcgac
tcacgaggacacctaatgggaagatttgagcgtcattttacgcttgctgcttgccccata
tatcacaacctgaccccggaaagatgtagagcaaaccatgaagccaacgaaaggttgagg
aaggatcaagcagaggatgctgggagggatcaagtcatcgttcatcacaacacaaggaac
caaacagaagtagaagcaactccaagccaagctaagtatcggaagagagtccagagaagc
agggagcaacattcatcctctgagcatcggaagagcgatccagagcatcaagcagagcat
ggagtgaaggaacctcttcttaaccacgtcgcttccgaatacgacctcaacttgttccgg
caggcacaagcactggcatccgaagggttggagcacgaactggaacgtttgcatgaatcg
ggtttgttgtcgcaagatggttcgaacccggatcgaagaatcaaagttattgagatcggt
cgttacgagatggatacttggtattcctcgccctaccctgaagaatatgttcaacttcct
aagttgtatatttgtgaattctgcttgaaatatatgaagagttcaaccattctgagaagg
catatggctaagtgtgtatggagacatcccccaggggacgagatttatagaaaaggaacg
atttctgtgtttgaggttgacggtaagaagaataagatatacagccagaacttatgcctg
ctggcaaagttatttcttgaccataaaacactttattatgacgtcgaaccgtttctattc
tatgtgatgacggaggctgatttgacgggctgtcacatggtgggttatttctcaaaggag
aaaaattctttcctgaattacaacgtgtcgtgtattttaaccatgccacaacacatgagg
aaagggtatggaaagatgatgatagacttcagttatttactctcaagaaaagaaggaaaa
actggatctccagaacgaccgttgtcggaccttggacttctgtcttatagaagttattgg
acagatattattattagttatttatcaaagctggatgcggctgctgacttggtgattcga
gatatcagccaagaaaccgcagtccaccccgctgacatagtaagcactttacaagccctg
cagatgcttaagtattggaagggaaaacatattatattaaagaagcaggatattattgaa
gattggttgagaaaacaaacaaagaagccggccgagttttcgtctcgtgcgattgattca
aaatgtttgaaatggtctcctacacgccagaaagaataa

DBGET integrated database retrieval system