KEGG   Ciona intestinalis (sea squirt): 778882Help
Entry
778882            CDS       T01056                                 

Gene name
zf(mynd)-3
Definition
zinc finger protein
Orthology
K11847  
ubiquitin carboxyl-terminal hydrolase 19 [EC:3.4.19.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     778882 (zf(mynd)-3)
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   778882 (zf(mynd)-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1145 aa AA seqDB search
MPEANKNCANVVASLLLKRGNTTMARKRKTDGLPINSLVRMSWSQRFHDVYMILWKINDD
LNLDEVDILLTDCTCSIKLPNGESHFWHFFLDVESAMSQRIPSSNAIIIVMPKKDHTVFW
PTFKKVEGLSDIGKSNFQNAPPKKMFLEESEKNTSFQDEFTTSGATPCNFPIKMETSPSV
TMATGIKVPHGVLIGGNSPLTHHTAGSRTETKSLDKIDGQSSKLNPEINKELTTELDGLV
HHWRSKSKGCIVLDLQLNKSDVCDVKVEFYEMAVVVKFRNSSSDFCRKHIVLENSLLQWK
TQLSFSIIPDKCSFSIMDTFVQLTMQKKTTDHLETLLHESGHLVSPNTVGDTKKISQPGL
GYTGLINLGNTCFMNSVIQALANTPELRNYFLDEKFHCHINTKNPLGVGGKMAKAFYVVM
RKLWGCSNKAFSPHEFRDVVGLKGSRFTDGMQHDAHEFMAFLLDMLHEDLNTARNSTSIQ
PTSEVKGISEEMMAFEAWKSYLSRSGSFIIENFHGLLKSQLKCLVCKTKSVKFDPFLFLS
VPLPKKVQPFSVFFFRKDVSEPIKITVSVHSDGAKMSDVLSQVGIHTGTNINHLVSYEVN
NNALCRFFVPTSPLIRNSHTSTVHIQEMLSPEKEGEPVLQIICTQRKMVPDINKHCAYCK
REPDNSFELKRCMNCLKVAYCDRDCQKGGWLKHRNVCRRTPELVGHPFVMCIAKSKATYT
NVKSLAVKWAKLSSDVEILSSSMDGENANGEHSVSEMPMELRFSSWKENKNEVYPVIEDK
GEELLDFSSRKFLSILWQNDKSKKNYVKVSDKAQDFSAPGRTMDLAKKSSPKYDLLECLS
LFTEPEILTQDEAWYCPQCKKHRQAMKKMSLWDLPDVLIIQLKRFSFKNYLWRDKINMFI
DLPVSNFDMTSYCNNPKTSKSLCYDLFAVINHHGGILGGHYTTNVRLPDVNNTSESVVDW
RLCDDRHVTKLNNKVVTEAAYVMFYHRRSSKNSNTMSESLNIPHEPQADEAQCDEATNAT
SEHQPVINTNGEKSETTETSVKHMTNSNETSLPLEESKQKIVNTTTVNDSPLSPVGRSAQ
KLSKMQIEKSVDSKPSEEHNIDQITTQNSNSQQTAQLRNCINSGDSGLKPQGKEVLSYTD
MDAID
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgccggaagctaataaaaattgcgcaaatgtagtcgcttcactgttgttgaaaagaggt
aatactacaatggcgaggaaacgaaagacggatggattacccataaactcgttggttcgc
atgagttggtcccagagatttcatgatgtttatatgattttatggaagattaacgatgac
cttaatttggatgaagtggatatcttgcttacagattgcacttgctctattaagctacca
aatggtgaaagtcatttttggcatttcttccttgatgtagagtctgcaatgtcacagcgt
attccatcatctaatgccattatcattgtgatgcctaagaaagaccatacagtgttctgg
cccacttttaagaaagtggaagggttaagtgatattggaaagtcaaactttcaaaatgcc
cctcccaaaaaaatgtttctagaggaatcggaaaaaaatactagttttcaggatgagttc
accacttcgggggcaaccccatgtaactttccgatcaaaatggagacttctccatctgtt
accatggcaacaggcattaaagtccctcacggcgttctgattggtggtaatagcccactt
acccaccatactgctggttcgagaacagaaacaaaatcccttgataaaattgacggacaa
agctcgaagttaaatcctgaaataaataaagagttgacaactgagttagatggtcttgtc
catcattggcgctccaagagcaaaggttgcattgtgttagacctccagttaaataaaagt
gatgtctgtgacgtcaaagtggagttttatgaaatggccgtcgttgtcaaattcagaaac
tcgagctctgacttctgcagaaaacacatagtacttgagaactcattactgcagtggaaa
actcagctaagtttttccatcattcccgataaatgcagcttcagcataatggacacattt
gtacaactaaccatgcagaagaaaacaactgaccatcttgaaacacttctgcacgaaagt
ggtcacttggtctctccaaatacagtgggagatacaaagaaaatatcacagcctggtctt
ggatatacaggtttaataaacttgggaaacacctgctttatgaacagtgttattcaagct
cttgcaaatacaccagaactgcgcaattattttcttgatgaaaaatttcattgtcatatc
aacacaaaaaatccactcggagttggtggtaaaatggcgaaagcattttacgtggttatg
cgcaaactttggggttgttctaataaagccttttctccccatgagttcagggatgtcgtt
ggattaaaaggatctcgtttcacagatggaatgcaacatgacgcacatgagtttatggct
ttcttgctcgacatgctgcatgaggatctcaacacagcaagaaactcaacctcaatccaa
ccaacaagtgaagtgaaaggaatttcagaagaaatgatggcgtttgaagcgtggaagtcg
tacctatctcgctctggttcatttatcatagaaaacttccatggtttgctgaagtctcag
ctcaaatgtcttgtttgcaaaacaaaatctgtcaagtttgacccgttcttgtttctctcc
gttccacttcctaagaaagttcagccgttttcggttttctttttccgaaaagacgtcagc
gagccaataaagattactgtctctgtgcattcagatggtgcaaagatgtccgacgttctt
tcccaagttgggattcacactggcaccaacatcaaccatctggtttcatatgaagtaaac
aataatgcattgtgtcgcttttttgttccaacttcaccactgatccgtaactcccacacc
tcgacagtgcacatccaagagatgctctcaccggaaaaagagggcgaaccagtgcttcag
attatttgtactcagcgcaaaatggttcctgatattaataaacattgtgcttattgcaag
cgtgaacctgacaacagtttcgagctcaaaagatgcatgaactgcttgaaagttgcttac
tgtgacagggattgtcaaaaaggtggttggcttaaacatagaaacgtatgtcgacgtaca
cctgagttggttggtcatccatttgtgatgtgtattgcaaaatctaaagcaacttacacc
aatgtaaagtcactggctgtgaaatgggcaaagttaagctctgatgttgagatccttagt
tcttccatggatggtgagaatgctaatggtgaacattctgtttcagaaatgcctatggaa
ttacgtttctcatcttggaaggaaaataaaaatgaagtttacccagttattgaggacaaa
ggtgaagaactattggattttagttccagaaaatttttatcaattttgtggcagaatgac
aaatcgaagaaaaattatgtcaaagtttcagacaaagcacaagatttcagtgccccgggt
aggacaatggatcttgctaaaaaatcctcaccaaaatacgatttactggaatgccttagt
ttgtttactgagcccgagatattaacccaagatgaagcttggtattgcccacaatgcaaa
aagcaccgacaagcaatgaagaaaatgtcactttgggatttgccagatgtgctaataatt
caactcaagcgattttcttttaagaattatctctggagagacaaaatcaacatgtttatt
gatcttcctgtcagcaactttgacatgacatcttactgcaacaacccgaaaacctccaag
tcactttgttatgacttgtttgcggtaattaaccaccatggagggatactagggggccat
tacacaaccaacgtgcgtcttcctgatgtaaataacacctcagagagcgtagttgactgg
cgtttatgtgacgacagacacgtcacaaaactcaacaacaaggttgttactgaagctgca
tacgtcatgttctaccacagacgctctagtaaaaactccaatactatgtcggaatcattg
aatataccacatgaaccacaagcagatgaagcacagtgtgatgaagccacaaatgcaact
tcagagcatcaacccgttatcaacacaaatggagagaaatctgaaacaaccgaaacctct
gtaaagcatatgaccaattccaatgaaacatcccttcccttagaagaaagcaagcagaaa
atagtaaataccacaactgtgaatgattccccattatccccagttggcagatcagcacag
aagctttctaaaatgcaaattgagaagtctgtagactctaaaccctctgaagaacacaat
attgatcaaataaccacacagaattccaattctcaacagacagcacagcttagaaattgc
ataaattcaggagattcaggattaaaacctcaaggaaaggaagttctttcttacacagat
atggatgcgatcgactga

DBGET integrated database retrieval system