KEGG   Ciona intestinalis (sea squirt): 778902Help
Entry
778902            CDS       T01056                                 

Gene name
mapkk3/6
Definition
mitogen-activated protein kinase kinase
Orthology
K04433  
mitogen-activated protein kinase kinase 6 [EC:2.7.12.2]
Organism
cin  Ciona intestinalis (sea squirt)
Module
MAPK (p38) signaling
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     778902 (mapkk3/6)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   778902 (mapkk3/6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 348 aa AA seqDB search
MATHGNGPNKSTDSGPALPVRRRKKNNKLKVRIDPPEQTPKVPIVPHKPQSRMNINGQDI
DIRADDLTIVEELGRGAYGVVDKMKHKSTETIIAVKRIRATLNTQEQKRLLMDLDVSMRS
VDCDYTVTFYGALFRQGDVWICMEVMDTSLDQFYKKVKDRGLKTGEDVLGIIAVSIVKAL
RYLQETLHVIHRDVKPSNVLLNKNGQVKLCDFGISGQLVDSLVKTIDAGCKPYMAPERID
PAQNQQGYDVKSDVWSLGITMIEVATGDFPYDTWRNPFQQLKQVVEDPSPKLPANTFSLE
LDDFCRCCLNKDPSKRPNYRELEDHVFVQKHLHEDVRSISSFITLILE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcatggaaatggtcccaataaatctacggattcgggaccagcactaccagtt
cgaagaagaaaaaaaaacaacaaattaaaagttcgtattgatcctcccgagcaaacccca
aaagttccgatcgttccgcacaaaccacaatcgaggatgaacataaatgggcaagacatc
gatattcgcgctgatgatctgactatagttgaagagttaggacgaggggcgtatggggtc
gtcgataagatgaaacacaaatctaccgaaacgataatcgcggttaaacggatccgtgcc
accttgaacacacaagaacagaaacgacttctgatggatctcgatgtctcgatgagatcg
gttgattgtgattatacagtcactttctacggggcgcttttccgacaaggagacgtttgg
atttgcatggaagtgatggacacctctctcgatcagttttataaaaaggtgaaggaccgt
ggtttaaagacgggtgaggacgtgttgggaataatagcggtgtccatcgttaaagcactt
cggtatttacaagaaactctccacgtcattcatcgggatgttaaaccttccaatgtattg
ttgaacaagaatggccaggtaaagttgtgcgactttggaattagcggacaactcgtcgac
tcgctcgtcaaaaccattgacgctggatgcaaaccttatatggcgcccgaacgcatcgac
cctgctcaaaaccaacaaggatatgacgtcaagagtgacgtatggagtcttgggattacc
atgatagaagtcgccaccggggatttcccctacgacacctggcggaatccatttcaacaa
ttaaaacaggtagtagaagatccttcccccaaacttccagccaacaccttctcgctcgaa
ctcgacgacttttgtcgatgttgtttaaacaaagatccgtcgaaacgcccaaactacagg
gaacttgaagatcatgtgtttgtacagaaacatcttcatgaggacgttcgcagtatttct
tctttcataactcttattcttgagtga

DBGET integrated database retrieval system