KEGG   Ciona intestinalis (sea squirt): 778906Help
Entry
778906            CDS       T01056                                 

Gene name
ash1l, Ci-ZF(PHD)-13
Definition
absent, small, or homeotic discs 1 homolog
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    778906 (ash1l)
Enzymes [BR:cin01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     778906 (ash1l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 2850 aa AA seqDB search
MDQQSGSGEAIHDSSRGGDLFTFLYNFINQSAELQGASTQSGILTAPSNIVVTANIAENI
VQNIQNIDPVLQGGLLDNHLVDFPVSPDKTTLSTGCSCAGTGSGSANRSVQTTSGPSVSG
YQLNNNNNSKEDFIDHSNICKTINDINNNQQQSDNFPPSTSMPQNTGHPMSNISVPASGG
EFLQAPLHPPPIQIDSSQNFPLQNWNMDAAGNTMNLSEVYATSSLHYPTPEMNQATIPVY
PNTGLDQSYLQGVIGNTGFVPQQQFNLHRTNQINHLLQNSLPMQELNSALLRPDNLSVSR
SQEMPVMSSAYGINAYHQNSNYNTMNKVSLTQNVNQQVVDYDAYNNNGTVGALRHSSTVR
KSSRHESGSEESLVEDRTGEKKLTSTPIPSDAEKTCSSSVSSGSHEESPSPQEVDVGNPQ
KQVQIPCSGSSFSNVEQQDEDPEFQQLVGDTSIDAAANLIPVAENVVEIDQETGDSPVPE
NVTSSAQSASKSSQNKNYPQSNGGSNKILQASWTHTKPHTSITEASNAAKKKERMANESK
DSWSVRKEERRKRRLHKKRLKAKQMQSDSGEYEAHDRIEQLGTMSTENYSGHDSHGGSNH
PHRKHHRTNDSWDKMVNGASEQIQSSQSEQYPTAYRGLIPKATADPTNNANIIAKNNRLQ
EGHRKDFRKHKHSEKKRSKVRLKSQMTPDSTRENSSLQQNAFLQENGAIKSSGSTGKSNE
VIKPSDIQPTTNHNDGENSNNNLSANQGGNIGVRRWQTVTAVQGPKLPPMLSERDRIPKR
GRPSKKMTEQNLKLKAEALQAAQKKADTNTPKAPVVPPTGSNLVSLYTINDKGFIQEIAN
KPKESRRSKERAEAFLTMLSEISKKSSIQTKTPSAKDAVGAFKAVGVRTRKQASTGSSAE
KKKSRSSKVFGGECAPASTKELNKSADGMNEHGVYTFSELAKQYKISDSILYRAMEQSQR
GVNSKSKVSKSVQKPKLEKSNRSVKPHSKTESKNEPLTTVKPTTQSASYKVDSSKAEHKL
PTAEKTSTSSTSQFSSESSTLKPISLSSEKATELSELELPSPTHVQKIKRKKKKKKHKRE
RDEDGKRKRNKEKKKKSKHKHKRSREASDSVFTTTEINNSSEHLSSTPQLPRTSAKTHMP
KSAASLSKHKDSSPSVTSNNSASTSKRDRSVSSLSGLDEDQAYDAGDSSSDADVTKQTCE
KSRKKSSSNGISTSAASAVFGSSVSSVMPSFHAIKEHGGLEQLSEQTKRLEGHESLIKKH
KHKRKKLVRRTKSISDPKFLGNMEELVQSLQNVKISESESFLSSSIVSKSNIFAKKPGLF
SGMSNQHNLFSGDAFSYRDPSKNSKSKNPSFSKSTSIETADSSLNFGKSDRYGFSSFCRS
NFFQAHGFIKKHTGPPIRPFMSNANANSEQSFIFSTSESAYRNEPLPSKFSNIDSSKTGV
PCSESLREDEGPGSSKKGGKRKRGWPLGRPRGPRMKRSMLDASDSSASSVGSNFTTKNNP
GSLTSSAGDNDGNKLFPADSQLCDTYQTGKAIEQDSNNSKKSKKGNTEKATTSSQQAPFA
DDLVSHIKAVITATLTQSELSTEKVSKTVDIAVADYLQYKKTSSQPDEKTVSHLKTLSKS
DSGPPVKKARGRPPKVTKKNKSDSRNVINEPEDQNLDLLKEKSTKKPTANQVKSDNDTSD
DDLPLKARMNNFSRKRGPGRPRKSDDLTTSVPSQKDQVHVDQSRNRTRRSSSLLTSATRK
FKQTAQKTKSTVVKTKRGSTLKQSTNVSTNGAISCQKAKVAVGACLSYKALNQQSQSASW
IRSLNSPPPGMYDGMQADKHMDEAIEDAIIKCNKPTPPTKTICCTVYDHAHKPVSKKSLE
SVVAKLKRKQTSVENSESEGNSNANNNGHVKLEEGVETAAAGKLSHAARKISNESEVSSP
CADEATQLDFYGDASDLNLMQNRKEKQVGHASAAGISIADGQSTSMLLPQRKKTFLKSGL
FSSHFKTQSGEDVEDEDVNELLPMPIHAGNFLLKSRKDFQLPFNIWWMYNRKLISPSQDL
ATQFIKIEKNVYVDSQPTCEQEEHVCVCQTLSDIHSLSSDVHGCGKECLNRLMYIECSPD
TCPCQDKCANRCIQKQQWWKDLERFRTNDRGWGVRTNSDIPEGQFLLEYVGEVVSEREFR
RRTIENYNAHNDHYCVQLEAGTVIDGYRLANEGRFVNHSCQPNCEMQKWVVNGEYRVGLF
AKRPIVSSEELTYDYNFHAYNLDRQQPCRCGSSECRGVIGGKTQRGAEQGGKTRSTLHPT
KERRPKHASCETHLYSTTTQDQNIEVGTRKYKVEQMPSISEDEKKFVKRSRLFLLRNMRQ
TKINHEKSSPRTHPHDDTDHESDESETSTKSTLLRDAINDVFTAVMTCKDENGVSVAIPF
INLPSKTQNPEYYDHVTDPVDLSFVEQKIVTKEYENFQEFCVDLQRVFRNAEKYHGRKST
LGRDVARLRRSFACARSLAAATLGEDEEDEKKKECSAQQKELDERRKNGDYIRCICGIFK
DEGLMIQCEKCYVWQHCDCMDARPDDYNDERAYLCEECDARQVPSQVRVVPQPPNAPPGH
TYYLTLMKDDMQVKQGDCVRMIHDHRLRQRPSSQPPVRSSYRLQSHSTPDTMDFFRIKKL
WTDDNGDKFAYGHHFLRPHDTRHNEGRLFYNNELVATPFHEIVPLEAVVSICCLMDFETY
CLGRPKGVKDEDIYICQHRVDLSFRIVERVIKTRYPTCTKPHVFDVYPSKLEPTKDLLVP
EQYRKNAFRRTLWLKSTEHGNMKSDEDESSGDEEVCLPSQGESIEPDALMADDVSMEDNA
DNRDVKQRRLNGILSKLMKDANSRNLQAST
NT seq 8553 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcaatcgggcagtggtgaagctatacacgattcctcaaggggtggagacctt
tttacatttctctacaactttattaaccagagtgcagagctacagggcgcgtccacacag
agcggaattttaaccgcaccttccaatattgtcgtcacagcaaatattgctgaaaatatt
gttcagaacatacaaaacatagatcctgtacttcaaggtggtttattggataaccacctt
gtcgactttccagtatcaccagacaaaaccacattaagtaccggctgttcttgtgctggt
actggtagtggatcagctaacagatctgttcaaacaacgtcaggtccaagtgtttccggt
taccagcttaacaacaataacaacagtaaggaagacttcattgatcactccaacatttgt
aaaacaatcaacgatataaataacaaccaacaacagtccgataactttccaccctccaca
agcatgccacaaaacactggtcatccgatgtccaacataagtgttcctgcatccggagga
gagtttcttcaggctcctctacatccgcctccaatccagattgattcttcgcaaaacttt
ccccttcaaaactggaacatggatgctgcaggaaacacaatgaatttatctgaagtatac
gccacctcgagtcttcactacccaacaccagaaatgaaccaagctactatccctgtctac
cctaacactggattagaccaaagctacttgcaaggtgtgatagggaacacagggtttgtt
ccacaacagcagtttaacctacatagaaccaaccagataaaccatttgctgcaaaattcc
ctccccatgcaagaacttaactcagctttgctcagaccggataacctatctgtttcaaga
agccaagaaatgccagtcatgtcttcagcatatgggatcaatgcttatcatcagaattca
aattataacacaatgaacaaagtttcacttacacagaacgtcaaccaacaagttgtggat
tatgatgcttataataacaatggtacagttggtgctcttcgtcactcttccactgtcaga
aagtcctccagacatgagagtggtagcgaggagagcttagtggaggatcggacaggagag
aagaaacttacgagcactccaatcccctcagatgcagagaaaacctgcagtagcagcgta
agcagcgggagccatgaagagtcaccaagtccccaggaagtggatgttggaaatcctcag
aagcaggtgcagataccttgcagtggatcctcattttcaaacgttgagcagcaagatgaa
gatccggagttccagcagttagtcggagatacttccattgatgcggcggcaaatttgatt
cccgttgctgaaaatgtggtagaaattgatcaagaaactggagattctcctgttcctgaa
aatgtgacttcttctgcacagtctgcgtcgaaaagttctcaaaataagaattatcctcaa
agcaacgggggttcgaataaaatcttacaagcaagttggacacatactaaaccacatacg
tccattactgaagcatcgaatgcggcaaagaaaaaagaaagaatggctaatgagagcaaa
gactcttggtcagttcgtaaggaagagaggagaaaacgtcggctgcataaaaaacgacta
aaagcaaagcaaatgcaaagtgattctggagagtatgaggctcatgatcgaattgagcag
ctgggaactatgagcactgaaaactacagtggacatgactctcacggcggcagcaatcat
cctcatcgaaaacatcacagaaccaatgactcctgggataagatggtgaatggtgcaagt
gagcaaatacagagctcacaatccgaacagtatccaactgcttatcgtggtttgattcct
aaagcaactgctgatcccaccaacaatgcaaatataattgctaaaaataaccgattgcaa
gaaggacaccggaaagactttcgaaaacataaacacagcgagaaaaaacgatcgaaagtg
cgactaaaatcgcaaatgactccagattccacaagagaaaattcatctctgcaacagaat
gcttttttacaagagaatggtgccatcaaaagcagtggttcaactggaaagtcaaatgaa
gttattaaaccttcggacattcaaccaaccaccaatcataatgatggtgagaactcgaac
aacaatttatctgcgaaccagggaggaaatattggtgtacgaaggtggcaaactgtcact
gctgtgcaaggcccaaaactaccacccatgttatcagaaagggaccgtattccaaaaaga
ggtagaccctcgaaaaaaatgactgagcagaatttaaaactaaaagcagaagccttgcaa
gcggcacaaaagaaagccgatacaaacacacctaaagcacctgtagttccaccaacagga
tctaatcttgtttccttgtacaccataaatgacaaaggatttatacaggagattgccaac
aaacctaaagaaagccgacggagcaaagagagagccgaagcttttttaacaatgttgtcg
gaaatatccaagaaaagttcaattcagaccaaaactcccagtgcaaaagatgcagtcgga
gctttcaaggctgtcggcgtgaggacaaggaaacaagcatcaaccggatcttctgctgag
aaaaagaagtctcgctccagcaaagtctttggaggtgagtgtgctcctgcttccactaaa
gagctgaataaatctgcagatggcatgaatgaacacggtgtgtacactttctccgagctt
gccaagcaatacaagatctctgactctattctatacagagcaatggagcaatcgcagcgt
ggtgtgaattccaaatcaaaggtatccaaatcagtccagaaacctaaattggaaaaatct
aatagatcagtgaaaccgcatagtaaaacagaaagcaaaaatgaacctcttaccactgtg
aagccaactacccaatctgctagttataaggtagattctagtaaagcagaacataaacta
cctactgctgagaaaaccagtacaagcagtacttctcagttttcaagtgagtccagcacc
ctcaagcctatttctctatcaagtgagaaagccaccgagttatcagaattggagctacca
tctccaactcatgttcaaaagataaagaggaaaaagaaaaaaaagaaacacaaaagagaa
agagatgaggatggaaagagaaaaagaaacaaagagaagaagaagaaatcaaagcacaag
cacaaacgatcaagagaggcgtcagattctgttttcacaactaccgagataaacaacagt
tcagaacatttgtcctccactccacagttacccaggacaagcgctaagactcacatgccc
aaatcagctgcttctctatctaaacacaaagattcaagtccatctgtaacatcaaataac
tctgctagcacatcaaagagagatagaagcgtctcaagtttatcaggtctggatgaagat
caggcatatgatgctggagacagctcttcagatgctgatgttacaaagcagacctgcgaa
aaatctcggaagaagtcttcgtcaaatggaatatccacctctgcagcatcggctgtgttt
ggctctagtgtttcctcagttatgccatctttccatgcaattaaggagcacggcgggcta
gagcaactgtctgaacaaaccaaaaggcttgagggccatgagagcttgattaagaaacac
aaacacaagcggaagaaacttgttcgtcgaactaaaagcatctccgacccgaagttcctt
ggcaacatggaagaacttgtgcaaagtttacaaaatgtaaagatctcagaatccgaatcg
tttttgtctagctccattgtatcaaagtcgaatatttttgccaagaaacctggtctgttc
tctggtatgtcaaaccaacacaatctttttagtggagatgctttttcatacagagatcct
tcgaaaaactccaaatccaaaaatccttcattttcaaaatctacatctattgaaacagca
gacagttcgctcaactttggaaaatcagatcgctacggattttcttcattctgcaggtca
aacttttttcaagcgcacggatttatcaaaaaacacacagggccaccaatcagacctttc
atgagcaatgcaaatgccaacagtgagcagagctttattttttcaacaagtgaatcagca
tacaggaatgaacctttaccttccaaattcagcaacatagatagctccaaaactggtgtc
ccttgctctgagtcattaagagaggatgagggccctggaagcagtaaaaaaggtgggaag
aggaagagaggatggcctcttggaagacccagaggtccacgtatgaagagatcgatgcta
gatgcaagtgacagctcagcaagcagtgttggatcaaattttacaacgaaaaataatcca
ggttccttgacaagctctgctggagataatgatggaaataaactgtttcctgcggattcg
cagctttgtgatacttatcaaactggtaaagctatagaacaggactccaacaacagtaaa
aaatcaaagaaaggtaatactgaaaaagctacaacatcatcacagcaagccccctttgct
gatgatctggtcagtcatattaaagcagtgattactgccacacttactcagtctgaacta
tcaactgaaaaagtttcgaaaactgttgatattgctgtggctgattatctgcaatacaag
aagaccagttcccaacctgatgagaaaactgtgtcacatctaaaaactttgtccaagtct
gacagtggaccacctgtgaaaaaggcaagaggaagaccacctaaggtcacaaagaaaaat
aaatctgatagccgtaacgtaataaatgaaccagaggaccaaaatcttgatttactgaaa
gaaaaaagtacaaagaaaccaacagcaaatcaggttaaatcagataatgatacttctgat
gatgatctaccattaaaagcaagaatgaacaatttctcgagaaagcgtggtccaggtaga
ccaagaaaaagtgacgatttaacgacatctgtgccctcacaaaaagaccaagttcatgtg
gatcagagtcgcaacagaaccaggagatcttcaagtcttctaacatcagctacaagaaaa
ttcaagcaaacagcgcaaaaaactaagagtacagttgtaaaaaccaagcgaggcagtacc
ttgaaacaatccactaatgtgtctactaatggagctatttcatgtcaaaaagcaaaagta
gcagttggtgcttgtttgtcatataaagctcttaaccaacaatcacaatctgcttcatgg
attagatcactcaattcacccccacctggtatgtatgatggcatgcaagctgacaagcat
atggatgaagcaatagaagatgcaataatcaaatgtaacaaacccacccctccgactaag
actatatgctgcacagtttatgatcacgcacacaaacctgtgagcaaaaagagcttggaa
tctgtggttgcaaaactaaagagaaaacaaacttctgtggagaactcggaatctgaagga
aactcgaatgcaaataacaacggtcatgtaaaattagaggagggtgtggagacagccgca
gctggaaaactcagtcatgctgctcgaaaaatatcgaatgaaagcgaagtttcaagtcca
tgtgcagacgaagccacccaacttgacttttatggcgacgcgtcagatttgaatttgatg
caaaacaggaaagagaagcaagttgggcatgcctctgctgctggaatatcaatagcagat
ggccaatccacttcaatgcttcttccacaacggaaaaaaactttccttaagtctgggcta
ttttcatcccacttcaaaacacaaagtggtgaggatgttgaagacgaagatgtcaatgaa
ttgctcccgatgccgattcatgccggcaacttcctcttaaaatcaagaaaagatttccag
cttccatttaacatatggtggatgtacaaccgcaaactaatctcgccaagccaggatctt
gccacacagttcattaagattgaaaaaaacgtgtacgtggacagccagccgacatgcgag
caagaggaacatgtatgcgtctgccaaaccctttccgacattcattccctctcctctgac
gtccatggctgcggaaaggaatgtctcaaccgactcatgtatattgagtgttcccccgac
acctgtccgtgccaagacaagtgtgcgaaccgatgtatacagaagcaacagtggtggaaa
gatctcgaaagatttcgaaccaacgatcgtggttggggggttcgtaccaactctgatata
cctgaaggccagttcttactggaatacgtcggtgaggttgtgagcgaacgcgagttccgg
cgtcgaacaattgagaattacaacgctcataatgaccattattgtgttcaattggaggct
ggtacggtgattgacggctacagacttgctaatgagggaagatttgtgaaccacagctgc
caaccgaactgtgagatgcagaaatgggttgtgaatggtgaatacagggtcggtttattc
gcaaaacgcccaatcgtcagcagcgaagagctcacgtacgactacaacttccacgcatat
aacctggaccgccagcagccgtgcagatgcggtagctcggaatgccgaggagtgattggt
ggaaagacgcaaagaggagcggagcaaggaggaaaaacgaggagcacgctccacccgacc
aaagaacgtcgaccaaaacacgcatcatgtgaaacacatttatattcaacaacaacacag
gaccagaatattgaagtgggcacgagaaaatacaaggtcgaacagatgccttcgatatca
gaggacgaaaaaaagtttgtgaagcgatctcggctgttcctgcttcgcaacatgcgccag
acgaaaattaaccacgaaaagtcgtctccgcgaacccacccccacgacgatacagatcac
gagagcgacgagtcagagacatctacgaaatccactttgctacgtgacgcaatcaatgac
gtgttcactgcagtcatgacttgcaaagacgaaaacggagtttcagtcgcaataccgttc
attaatttaccttcaaaaacccagaatcccgagtattacgaccacgtgactgacccggtt
gatttgagtttcgtggaacaaaagattgtgacgaaagaatacgaaaatttccaggagttt
tgcgtcgatcttcaacgagtgttcagaaacgcggagaaataccacggcagaaaatcgact
ttgggccgtgacgtggctcgactgcggcgttccttcgcctgcgctcgttccctggccgca
gcaacgctgggcgaagacgaagaggacgaaaagaagaaggagtgctcggcacagcagaaa
gaactggacgaacgaaggaagaacggagattacataaggtgtatatgcgggatatttaag
gacgaaggcctcatgatacagtgcgagaaatgctatgtttggcaacactgcgactgcatg
gacgcacgacccgacgattacaacgatgaacgggcttacttgtgcgaggaatgcgatgct
agacaagttccctcacaagttcgagttgttccccagccacccaacgcaccacccggccac
acatattatctaacgttaatgaaggacgacatgcaagtcaaacaaggcgactgtgtgcgt
atgatacacgaccacaggcttcgacagcgcccatcgagccaaccaccagtacgatcatcc
taccgactccaatctcactccacaccggacaccatggactttttccgtataaagaagcta
tggacggacgacaacggagacaagttcgcgtacggtcaccatttcctccgtcctcacgac
accaggcataacgaaggtcgtcttttttacaataacgagttggtcgctactcctttccat
gaaatcgttccgctagaggcggtagtaagcatctgctgtctcatggactttgaaacatat
tgtcttggtcgaccgaaaggcgtgaaagacgaggatatatacatctgccagcaccgtgtc
gatctatccttccgtatagttgaacgtgtgataaaaactcgatacccgacatgtaccaaa
cctcacgtgtttgacgtctacccatccaaacttgaacccacaaaagatttattggtgccc
gagcaatacaggaagaatgctttccgtcgaactttgtggctcaaatcaacagaacatgga
aatatgaagtctgatgaagacgaaagtagcggcgacgaagaagtctgcctgccgagccaa
ggtgagagcatcgagcctgatgctctgatggctgatgacgtcagcatggaagataatgca
gataatagggacgtcaagcaacgacgtttaaatggaattctcagtaagcttatgaaggat
gccaacagcaggaatctgcaagcatcgacatag

DBGET integrated database retrieval system