KEGG   Ciona intestinalis (sea squirt): 778923Help
Entry
778923            CDS       T01056                                 

Gene name
mapkk1/2
Definition
mitogen-activated protein kinase kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    778923 (mapkk1/2)
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    778923 (mapkk1/2)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     778923 (mapkk1/2)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   778923 (mapkk1/2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 377 aa AA seqDB search
MPPKRKLNPLNLTLEGSSPIPNQQVSDLGKKMDELNIDETQRKRLDQFIKQKQKVGVMEN
AQNSDFTKKGELGAGNGGVVHLVVHNATGFVMARKLIHLEVKQAILNQITRELQVLHDCR
SPYIVGYYGTFYSDGEISICMESMDAGSLDLVLKKARKIPEIYLGKVSKAVILGLKYLRE
ERSIIHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGSKYTI
LSDIWSLGLSLIEMAIGRFPIPPPTASQIAAIFNTEVSGGSGKAPNPHDVARPMAIFELL
DYIVNEPAPKLPQGIFEKDFCDFVASCLKKEPKERSDLGELMKAPFIKNVSLTQYEFAKW
VCSTMGLKAPSPDTVPD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaaacgtaagttaaacccgttgaacctaacacttgaggggagttcgcctatc
cccaatcagcaggtctctgaccttggcaagaagatggacgaactaaacattgacgaaact
caaaggaaaagattggaccagttcattaagcagaagcaaaaagtgggagtcatggaaaat
gctcagaactctgacttcacaaagaaaggagaactgggtgccggaaatgggggtgttgtt
catcttgtggtgcacaacgcaactggctttgtcatggcgcggaaacttattcatttggaa
gtgaagcaagccatcttgaaccaaatcacacgagaattgcaggttttgcatgattgtaga
agcccgtacattgttgggtattatgggactttttacagtgatggggaaatcagtatttgt
atggaaagcatggacgctgggtcgcttgatttagtgctgaagaaggcgcgaaaaattcct
gagatttacttgggaaaagtgagcaaagctgttatccttggcctcaagtacttaagagaa
gaacgtagcatcattcatcgcgatgtaaaaccatcaaatattctcgttaattcccgagga
gagattaagttatgtgattttggcgtgagtgggcaactgatcgactcaatggccaactcg
tttgtagggacaagatcatacatggccccagaacgcttgcaaggatccaagtatacaatc
ctttcagatatctggtctcttggtctctcacttattgaaatggcaattggtagattccct
atcccgccacccacagccagccaaatagcagccatattcaacactgaagtgtcaggggga
agtggtaaagcaccaaacccacatgatgttgcacgaccaatggcaatctttgagctgctt
gattacattgtgaatgagccagcaccgaaactcccacaaggaattttcgagaaagatttt
tgtgatttcgtggcgagttgcttgaagaaagaaccgaaagagcgatcagatctcggggaa
ctaatgaaagctccatttattaaaaatgttagcttaacccagtatgagtttgctaagtgg
gtttgcagtactatgggtttgaaagccccgagtccagacactgtacctgattaa

DBGET integrated database retrieval system