KEGG   Ciona intestinalis (sea squirt): 778923Help
Entry
778923            CDS       T01056                                 

Gene name
mapkk1/2
Definition
mitogen-activated protein kinase kinase
Orthology
K04368  
mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Dorso-ventral axis formation
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:cin04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 377 aa AA seqDB search
MPPKRKLNPLNLTLEGSSPIPNQQVSDLGKKMDELNIDETQRKRLDQFIKQKQKVGVMEN
AQNSDFTKKGELGAGNGGVVHLVVHNATGFVMARKLIHLEVKQAILNQITRELQVLHDCR
SPYIVGYYGTFYSDGEISICMESMDAGSLDLVLKKARKIPEIYLGKVSKAVILGLKYLRE
ERSIIHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMAPERLQGSKYTI
LSDIWSLGLSLIEMAIGRFPIPPPTASQIAAIFNTEVSGGSGKAPNPHDVARPMAIFELL
DYIVNEPAPKLPQGIFEKDFCDFVASCLKKEPKERSDLGELMKAPFIKNVSLTQYEFAKW
VCSTMGLKAPSPDTVPD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctaaacgtaagttaaacccgttgaacctaacacttgaggggagttcgcctatc
cccaatcagcaggtctctgaccttggcaagaagatggacgaactaaacattgacgaaact
caaaggaaaagattggaccagttcattaagcagaagcaaaaagtgggagtcatggaaaat
gctcagaactctgacttcacaaagaaaggagaactgggtgccggaaatgggggtgttgtt
catcttgtggtgcacaacgcaactggctttgtcatggcgcggaaacttattcatttggaa
gtgaagcaagccatcttgaaccaaatcacacgagaattgcaggttttgcatgattgtaga
agcccgtacattgttgggtattatgggactttttacagtgatggggaaatcagtatttgt
atggaaagcatggacgctgggtcgcttgatttagtgctgaagaaggcgcgaaaaattcct
gagatttacttgggaaaagtgagcaaagctgttatccttggcctcaagtacttaagagaa
gaacgtagcatcattcatcgcgatgtaaaaccatcaaatattctcgttaattcccgagga
gagattaagttatgtgattttggcgtgagtgggcaactgatcgactcaatggccaactcg
tttgtagggacaagatcatacatggccccagaacgcttgcaaggatccaagtatacaatc
ctttcagatatctggtctcttggtctctcacttattgaaatggcaattggtagattccct
atcccgccacccacagccagccaaatagcagccatattcaacactgaagtgtcaggggga
agtggtaaagcaccaaacccacatgatgttgcacgaccaatggcaatctttgagctgctt
gattacattgtgaatgagccagcaccgaaactcccacaaggaattttcgagaaagatttt
tgtgatttcgtggcgagttgcttgaagaaagaaccgaaagagcgatcagatctcggggaa
ctaatgaaagctccatttattaaaaatgttagcttaacccagtatgagtttgctaagtgg
gtttgcagtactatgggtttgaaagccccgagtccagacactgtacctgattaa

DBGET integrated database retrieval system