KEGG   Ciona intestinalis (sea squirt): 778927Help
Entry
778927            CDS       T01056                                 

Gene name
p38
Definition
p38 kinase
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
FoxO signaling pathway
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    778927 (p38)
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     778927 (p38)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   778927 (p38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 364 aa AA seqDB search
MAEMTNNMASITFNHYELNKTDWEVPSKYEDLIPIGCGAYGSVCSTYNSELKMRMAVKKL
ARPFQSVTHAKRTYRELRLLKHMHHENVIGLLDVFTPATTLEGFTDMYLVTHLMGADLNQ
IIKSQKLTDDHVQFLIYQILRGLKYIHSAGIIHRDLKPSNIAVNEDCELKILDFGLARLT
DDQMTGYVATRWYRAPEIMLNWMHYNQTVDLWSVGCIMAELLTGKTLFPGSDHIDQLKSI
MNLCGTPREDLLEKIISQSARNFIKTLPIIPKKEFVNVFVGANPKAVDLLERMLVLDTDC
RLTASEALQHPYLEKFHDPDDEPSAPLYDKSYEDAEISIDEWKQLAYDEIINFEFTPDLI
ADFQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatgacaaacaacatggcgagcataacgttcaaccattatgagttgaataaa
actgactgggaggttccttcaaagtatgaggacttgatccctataggctgcggtgcttat
gggagtgtgtgttctacttataactctgagcttaaaatgagaatggccgtcaaaaagttg
gcaagaccgtttcaatctgtgacgcacgctaagcgaacatacagggaactgaggttactg
aaacacatgcatcatgagaatgttatcgggctgttagacgtcttcacaccagctactaca
ttggagggattcacggacatgtacctcgtcacacacttaatgggcgcagaccttaaccag
atcataaaatcacagaaactgacggacgaccacgtccagtttttaatttatcaaatccta
aggggtttgaagtacattcactctgcagggatcatacatcgagatctcaaaccaagcaat
atagcagtgaacgaagactgtgaactgaaaattcttgactttggtctggctagactcaca
gatgaccaaatgaccggatacgttgcaacgcgatggtatagagcgcctgagattatgtta
aactggatgcactacaaccagactgtagatctatggtctgttggttgcattatggccgag
ctgctcactggaaagaccctattcccaggctctgatcatattgaccagttaaagtcaata
atgaatctttgcgggacgccgagagaggatttattggagaaaataatctcgcaatcggcg
agaaatttcatcaaaacgcttcccataatccctaagaaggaatttgtcaatgtttttgtc
ggcgccaaccccaaagccgtggacctgcttgaaagaatgctggtgcttgacactgattgc
cgactaactgccagcgaagcgctacaacacccctaccttgagaagttccacgaccccgat
gatgaaccgagcgccccactgtacgacaaatcttacgaagacgcagaaatatcgattgat
gaatggaaacagctagcgtacgatgagattataaactttgaatttacgccggatcttatc
gctgatttccagtga

DBGET integrated database retrieval system