KEGG   Ciona intestinalis (sea squirt): 778965Help
Entry
778965            CDS       T01056                                 

Gene name
erk3/4, MAPK6
Definition
mitogen-activated protein kinase
Orthology
K06855  
mitogen-activated protein kinase 4/6 [EC:2.7.11.24]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     778965 (erk3/4)
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   778965 (erk3/4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 902 aa AA seqDB search
MQDDAAVIDGQSDEEHKLKANESQACDTRLITVDMSDISSRYRDVYPLGCGSRALIFSAI
DQQCRRRVAVKKIFVKQCTPSHKLKQLIREIRILRKMDHDNIVRMYHALASSSSRDNSSP
VNMASNLSLKNQVSFDSVYIGMELMDTDLRNVINHNQLSSNYIKLFTYQLLRGLKYLHSA
NVIHRDLTPSNVFINTDTLMLKIGDFGISRILDSEYEHSGYLSMTTTSTWYQSPEILLHP
RHYNQAADMWAAGCIFAEMLIGKPLFNGSNAMEQINLILKSVAVTRENWLSVTTAVCQDE
NCCLNKDAYNVRENGGIPRRPLRDLLPTSNHMAVNLLNQMLTFAQTDRVTAIDALMHPYL
ACYSNPFDEPVCGMPFSLEDELDEMDVTNIKQIIWNETSNLFSVPSNESNIVETSTEDCG
LRQSLKGSVCTNDSYKNLLALVQSSTHSNGSNTNRGITISESEARTIACDFDYGVQINDG
SINRERMSIDFRPITSSAGCFDPYKWDSRCDSNTQQKQLTSAKEEPAKLGAHDGHHQEVV
SDHGYHSSYCSSNLSHGKVHAHALWSLSSPDVSIDHERTSGQRASTPDVGEASSPSAFEE
DHNSDYSRHSPTLSSEERDSDVTTSSRRRHKDDVPRHHQSYGHHYHHHHHHHHGHHHHHK
HHRHSSRHGSLSSASGGNTSHQRTSSNEAEPSSARCHQRRCLVNDTVPEVLEEPGSDVSS
NDRILPKDAPERKSSSSDSDSKTGRKKTCKMFPKFCKSRVKTTTGTTGGSAPADSGFHEP
FNISTPAVELKQRPNTAREGKTIRDGPSYTTPRLRTCSEGNRRNNPALILPKWKQLLETT
TDKSPFLHCQSLSDFNRIHPYSGGNDVSSSDVTSSDVSLSPPGKCSKSATPSFPRKRVEC
PF
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcaggatgatgcagcagtaatagatggtcaaagtgatgaagaacacaaactgaaagcc
aacgagtcgcaagcatgtgacacacgccttattacagttgatatgagcgatatttcttct
cgttatagagatgtttatccacttggatgcgggtcgagagctttaattttctccgcaatt
gaccagcagtgtagaagaagagttgctgttaaaaagatctttgtaaagcaatgtactcca
agtcacaaactaaaacaacttatacgggaaattagaattctacgcaaaatggaccatgac
aatattgtccgaatgtatcatgcacttgcatcatcaagttcaagagataatagctctcca
gtaaacatggcgtcaaatctatctttaaagaaccaagtttcttttgattctgtttatatt
gggatggaattaatggacaccgaccttaggaatgtaatcaaccacaatcagctttcatca
aactacattaagttatttacataccagttgctaaggggacttaagtacctacacagcgca
aacgttattcaccgtgatcttacaccttcaaatgtttttataaacactgatactctcatg
ctgaagatcggtgactttggaatttcccgaatcttagactcagagtacgaacattctggt
tatttatcgatgacaaccactagtacttggtatcaatcaccagagatcctccttcatcct
cgtcattacaatcaagcagcagacatgtgggccgctggatgtatatttgctgaaatgctt
attggcaaaccactattcaacggcagcaacgctatggagcagattaaccttatattgaaa
tcagtcgccgtaacacgggagaactggttaagtgttacgacagctgtttgtcaagatgag
aactgttgcttgaataaagacgcttacaacgtacgtgaaaacggcggaataccccgccga
cccttaagggacttgttgccaacctctaaccacatggctgtgaaccttttgaaccaaatg
ttgaccttcgcacaaacggatagagtgacagcgattgatgctttaatgcatccctacctt
gcgtgttacagcaacccgtttgacgaaccagtgtgtggaatgccgttttcacttgaggac
gaactcgatgagatggatgttaccaatataaagcaaataatttggaacgaaacttcaaat
ttgttcagcgttcccagcaacgaaagcaacatcgtagagacaagtacagaagattgtgga
ttgcggcaatcgttaaaggggtcggtgtgtaccaacgacagctacaagaatcttcttgca
ctagttcagtccagcactcatagtaacgggagcaacacaaacaggggaattacaatctca
gagtcggaagcaagaactattgcttgtgactttgactacggagtgcagataaacgatggt
tccatcaaccgtgagcgaatgtcgatagattttcgtccaattacttccagcgccggttgt
tttgatccctataagtgggattcacgttgcgacagcaacacacaacaaaaacaactgaca
tctgctaaagaagaaccggctaaactgggtgcacacgatgggcaccaccaagaagttgta
tccgaccatggttaccactcaagttattgctcgtccaatcttagccatggtaaggttcat
gcacacgcactgtggagtctttcatcgccagatgtttcaatcgatcacgaacgaacgtcc
ggacagagagcaagtactcctgatgtaggggaagcgtcatcaccctccgcatttgaagaa
gatcacaactcggattattctcgtcattccccaacgctcagttcagaggaaagagacagt
gacgtcactacatcaagtcgacgacgtcataaagatgacgtgccacgtcatcaccagagt
tacggccatcattaccaccatcatcatcaccatcatcatggccaccatcatcaccataaa
catcataggcacagcagtcgacatggaagtttatcatcagcgagtggtggcaatacatcc
catcaacgcaccagcagcaacgaagctgaaccatcttccgcaagatgtcaccaaagacgc
tgcttggtgaacgacactgtacccgaagtgttagaggaaccaggatcagatgtttcctcc
aacgatcgaattcttccaaaagatgcaccagaaaggaagagcagtagtagcgatagcgac
tcgaaaactggacggaaaaaaacttgcaagatgtttccaaagttttgcaaatcccgagta
aaaacgaccaccggaacgacgggaggttctgcccctgcagacagcggttttcacgaacct
ttcaacatttcaacacccgctgttgaattaaaacaacgacctaacacagctcgggaggga
aagactatcagggacggcccatcttacacaactccgcgattgcgaacatgctccgaagga
aatagaagaaataatccggcgttgattttgccgaagtggaagcaactgttggaaacaacg
accgataaatcaccttttctccactgccaatccctatctgactttaatcgcattcacccc
tactccggtggcaatgacgtcagcagtagtgacgtcacgagcagtgacgtatcactctct
cctcctgggaaatgctccaagtcggcaacccccagttttcctagaaaacgcgtcgaatgt
cctttttaa

DBGET integrated database retrieval system