KEGG   Citrus sinensis (Valencia orange): 102578010Help
Entry
102578010         CDS       T02983                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
cit00620  Pyruvate metabolism
cit00710  Carbon fixation in photosynthetic organisms
cit01100  Metabolic pathways
cit01200  Carbon metabolism
Module
cit_M00168  CAM (Crassulacean acid metabolism), dark
cit_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
cit_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
cit_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102578010
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102578010
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102578010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 102578010
NCBI-ProteinID: NP_001275821
UniProt: A0N072
AA seq 967 aa AA seqDB search
MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE
CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI
KKLKKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDALKNQTVDLVLTAHPTQSVR
RSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRA
GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMAANLYYSQIEDLMFEMSMWRCSDELRHRADVLHRSSKKDAKHYIEFWKQ
IPPNEPYRVILGDVRDKLYQTRERVRQLLAHGISDIPEEAVFTNVEQFLEPLELCYRSLC
SCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEE
KRQEWLLSELRGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVL
AVELLQRECHVKQPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALMDEMAVIA
TKEYRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVIQKDIKNLHMLQEMYNLWPFFRVTIDLVEMVFAKGDPGIAALY
DKLLVSEELQPFGEKLRANFAETKSLLLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVC
QAYTLKQIRDPNFHVKVRPHLSKEYMESRKPAAELVRLNPTSEYAPGLEDTVILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaataggaatttagagaagatggcatcgattgatgcgcagctgaggcttctg
gttcctcgaaaagtgagtgaagatgataagttgattgagtacgatgctcttcttttggat
cggtttcttgatattcttcaggatttgcatggagaggatctcaaagaaacggttcaagag
tgttatgaacttgcagctgagtatgaaggaaagaatgatcccagcaaatttaaggagctt
ggaaatgtcttgacaagtctggatccaggggactccattgtcattgccaaagctttctcc
cacatgcttaacttggccaacttggccgaggagcttcagattgcccaccgtcgaaggatc
aaaaagttgaagaagggtgattttgctgatgagaactcggcaacaactgaatcagacatt
gaagaaacattcaagagacttgtgggagagctgaataagtctcctgaggagatttttgat
gctctgaagaatcaaactgtggatctggtcttgactgctcatcctactcaatcagtccgc
agatctttgcttcagaaacatgcaaggattcgtaattgtttagcacagttgtatgccaaa
gatattactcctgatgacaagcaggagcttgatgaggctcttcaacgagagattcaagct
gcattccgtacagatgagatccgaaggacccaaccaactccgcaagatgaaatgagagcc
ggaatgagctacttccatgaaacaatctggaagggtgtacctaaatttttgcgccgtgtt
gacacagctttgaaaaacatagggatcaatgagcgtgttccgtacaatgccccacttatt
cagttttcttcttggatgggtggtgatcgtgatggcaatccaagggtaactcctgaggtc
actagggatgtttgcctattggctagaatgatggctgctaacttgtactattcccaaatt
gaggaccttatgtttgagatgtccatgtggcgttgcagtgatgagcttcgtcatcgtgct
gacgtacttcacagatcctcaaagaaagatgcaaagcactacatagagttctggaaacaa
attcctccaaatgaaccctaccgtgtgattcttggtgatgtgagggataagctgtatcaa
acccgtgaacgtgttcgtcagctattagcccatggaatctctgatattccagaggaagca
gtattcaccaatgttgagcagttcttggaacctcttgaactctgttataggtcactctgc
tcttgcggtgaccgagcgattgctgatggaagccttcttgatttcttgaggcaagtctcc
accttcggactctcacttgtcaggcttgatatcaggcaagagtctgatcgtcatactgat
gtcatagatgccattaccaagcacctggaaattggttcctaccgagaatggtctgaagaa
aagaggcaggaatggcttttatctgaacttagaggcaaacgtccactgtttggccctgac
cttcctaaaactgaagaaattgctgatgttttggagacatttcatgtcatagctgaactt
ccagctgataattttggagcatacatcatatcgatggcaacagcaccatctgatgtgctg
gctgttgaactcctacagcgtgaatgccatgtgaaacaaccacttagagttgttccactt
tttgagaagcttgcagatttggaggcagcacctgctgctctggcccgactcttttcagtc
gattggtacaggaatcggatcaatggtaagcaagaagtcatgattgggtactcagattct
ggtaaagatgctgggcgattctcggctgcctggcagttatacaaggctcaagaggagctt
ataaaggtagcaaagcaatatggtataaaactaaccatgttccatggtcgtggtggaact
gttggaagaggaggtggtcccacccatcttgccatattgtctcaaccaccagatacaatt
catggctcactgcgtgttactgttcaaggtgaagttattgagcagtcatttggggaggaa
cacttgtgctttagaacacttcaacgtttcacagctgcaacacttgagcatggtatgcgt
cccccaatttcaccaaaaccagaatggcgtgcactcatggatgagatggctgtcattgct
acaaaggaatatcgttctatagtattccaggaacctcgttttgtcgaatattttcgcctt
gcaacaccagaaatggagtatggtcggatgaacattggaagtcgtccatcaaagcgaaag
ccaagtggaggtattgagtcactccgtgccatcccatggatcttcgcatggactcagacg
aggttccatttacctgtgtggcttggctttggggcagcatttaaacatgtcattcagaag
gacataaagaatcttcacatgcttcaggagatgtacaatttgtggcctttctttagggtc
acaattgacttggttgaaatggtgtttgccaagggagacccaggaattgctgctttatat
gacaaactccttgtgtcagaggagctgcaaccatttggagagaaacttagggctaacttt
gctgaaactaaaagccttctcctccaggttgctgggcatcgggatcttcttgaaggagac
ccatacttgaagcagaggcttcgccttcgtgatgcatacatcacgacacttaatgtctgc
caagcctacactctgaagcagatacgtgaccccaacttccatgttaaggtccgaccacac
ctgtcgaaagaatacatggaatcaaggaagccagctgctgagcttgtgaggcttaaccct
accagtgaatatgctcctggtcttgaagatactgtcattttgacaatgaagggtattgct
gccggcatgcaaaacactggttaa

DBGET integrated database retrieval system