KEGG   Citrus sinensis (Valencia orange): 102607204Help
Entry
102607204         CDS       T02983                                 

Definition
phosphoenolpyruvate carboxylase 2-like
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102607204
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102607204
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102607204
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102607204
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 965 aa AA seqDB search
MAARNLEKMASIDAQLRLLAPAKVSEDDKLVEYDALLLDRFLDILQDLHGEDIRETVQEC
YELSAEYEGKRDSQKLEELGNVLTSLDPGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIK
LKKGDFVDENSATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVFTAHPTQSVRRS
LLQKHGRIRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRSPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTSEVTR
DVCLLARMMAANLYFSQIEDLMFELSMWRCNDELRARADGLHRSSKRDAKHYIEFWKQIP
PNEPYRVILGDVRDKLYNTRERARQLLANGISDIPEDIAYTHVEQFLEPLELCYRSLCAC
GDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESERHTDVIDAITKHLGIGSYREWSEEKR
QEWLLSELRGKRPLFGPDLPKTEEIADVLDTFHVISELPADNFGAYIISMATAPSDVLAV
ELLQRECCVKQPLRVVPLFEKLADLEAAPASVARLFSIDWYRNRISGKQEVMIGYSDSGK
DAGRLSAAWQLYKTQEELVKVAKQYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFSAATLEHGMHPPVSPKPEWRALMDEMAVIATK
EYRSIVFQEPRFVEYFRLATPEMEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHVIQKDIKNLHMLQEMYNLWPFFRVTIDLVEMVFAKGDPGIAALYDK
LLVSEELQPFGEKLRANFAETKSLLLQVAGHRDLLEGDPYLKQRLRLRDAYITTLNVCQA
YTLKQIRDPNFHVKVRPHLSKEYMESRKPAAELVRLNPTSEYAPGLEDTVILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctgctagaaatttggagaagatggcatcaatagatgctcaattgaggctactggca
ccggctaaggtctctgaggatgacaagttggtggagtatgatgctctgttgttggatcgc
tttcttgatattcttcaggacttgcatggggaggacatcagagaaacggttcaagaatgt
tatgagctttcagctgagtatgaagggaagcgcgactctcaaaagttggaggagcttggt
aatgttttaacaagtttagatcctggggattctattgtcgttaccaaatcattttcccac
atgcttaacttggccaacctggctgaggaagttcaaattgcttatcgacgaagaatcaag
ttaaagaaaggggactttgttgatgagaattcagcaacaaccgaatcagacattgaagag
accctcaagaggctcgtcgtgcagctgaagaagtctccagaggaagtttttgatgctttg
aagaatcagactgtcgatttggtcttcactgcacatccaacccaatctgtgcgaagatct
ttgcttcaaaaacatggaaggattcgtaattgtctgactcagttgtatgctaaggacatt
actcctgatgataagcaagaacttgatgaggctttacagagagagatacaagctgctttt
cgtacagacgagatccgaaggagtcctcctaccccacaagatgagatgagagcaggaatg
agctacttccatgagacaatctggaaaggagttccgaaattcttgcgccgtgttgacact
gctttgaaaaacattggcattaatgaacgtgttccctataatgctcctctcattcagttc
tcttcatggatgggtggagatcgtgatggaaaccccagggtaacttctgaagttacaaga
gatgtttgcttactggctagaatgatggctgctaacttgtacttctcccaaatagaggac
cttatgtttgagttatcaatgtggcgttgcaatgatgaactccgtgctcgtgcagatgga
cttcataggtcctcaaagagagatgcaaaacactacatagaattctggaaacaaattcca
ccaaatgagccttatcgtgttattcttggtgatgtgagagacaagctatataatacacgg
gaacgtgctcgtcagctgttagccaatgggatttctgacattccagaggatatagcttat
actcatgtggagcagttcctggagcctctagaactctgttacagatcactctgtgcttgt
ggtgatcggccaatagccgatggaagccttcttgatttcttgcggcaagtttctactttt
ggactttcactagtaagacttgatatccgtcaagagtccgaaaggcacactgatgttatt
gatgctatcaccaagcacttgggcattggatcttatcgagaatggtctgaggagaagcgg
caggaatggcttttgtctgagcttagaggcaaacgtcctctatttggtcctgatcttcct
aaaactgaagaaattgctgatgtgttggacacattccatgtcatttcagaacttcctgct
gacaactttggtgcctatataatctcaatggctacagctccatctgacgtacttgctgtt
gagcttttacagcgtgaatgttgcgtgaaacagcctctaagggttgttccattgtttgag
aagcttgctgaccttgaagctgctccggcttctgtggctcgtctcttctctatagactgg
tatagaaacaggatcagtgggaagcaagaggttatgatagggtattctgattcaggaaag
gatgctggccgtttgtctgcagcttggcaattatataagactcaggaagagcttgtaaag
gtcgcaaagcagtatggtgttaaactcacaatgttccatggccgaggagggacagtcgga
agaggtggaggacccacccatctggctatattgtctcaaccacctgatacaattcatggt
tcacttcgtgtgacggttcaaggagaagttattgagcagtcttttggggaggagcacttg
tgcttcagaacacttcagcgtttctcagctgctacacttgagcatggaatgcatccccca
gtctcaccaaaaccagaatggcgtgcactcatggatgagatggctgtcattgctacaaag
gaatatcgttctatagtattccaggaacctcgttttgtcgaatattttcgccttgcaaca
ccagaaatggagtatggtcggatgaacattggaagtcgtccatcaaagcgaaagccaagt
ggaggtattgagtcactccgtgccatcccatggatcttcgcatggactcagacgaggttc
catttacctgtgtggcttggctttggggcagcatttaaacatgtcattcagaaggacata
aagaatcttcacatgcttcaggagatgtacaatttgtggcctttctttagggtcacaatt
gacttggttgaaatggtgtttgccaagggagacccaggaattgctgctttatatgacaaa
ctccttgtgtcagaggagctgcaaccatttggagagaaacttagggctaactttgctgaa
actaaaagccttctcctccaggttgctgggcatcgggatcttcttgaaggagacccatac
ttgaagcagaggcttcgccttcgtgatgcatacatcacgacacttaatgtctgccaagcc
tacactctgaagcagatacgtgaccccaacttccatgttaaggtccgaccacacctgtcg
aaagaatacatggaatcaaggaagccagctgctgagcttgtgaggcttaaccctaccagt
gaatatgctcctggtcttgaagatactgtcattttgacaatgaagggtattgctgccggc
atgcaaaacactggttaa

DBGET integrated database retrieval system