KEGG   Citrus sinensis (Valencia orange): 102607534Help
Entry
102607534         CDS       T02983                                 

Definition
NAD-dependent protein deacetylase SRT1-like
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102607534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 465 aa AA seqDB search
MSLGYAEKLSYIEDVGNVGMAEFFDSPQILQEKIEQLAKLIQKSKHLVVFTGAGISTSCG
IPDFRGPNGIWTLQREGKPLPEASLPFHRAMPGMTHMALVELEKAGILKFVISQNVDGLH
LRSGIPREKLAELHGNSFMEACPSCGSEYFRDFEVETIGLKETSRRCSDLKCGAKLRDTV
LDWEDALPPKEMNPAEKHCKIADVVLCLGTSLQITPACNLPLKCLRGGGKIVIVNLQKTP
KDKKASLVIHGFVDKVVAGVMDLLNLRIPPYIRIDLFQIIVTQSLSSDKKFVNWTLRITS
VHGQTAQLPFIKSVEVSFSDRQKYKEASLDKQPFQLKRRTVINETFDIKLKLNFSDGCGC
PCTQINIPFDFKVPPKCFELDKDDIFQRLRETAFQDLGCGQNEVIERKVLSSPKSEVTVY
AIVSNVKTFESNCLSNGDLKWLKDGVNGTETSKKRSNSRKRKSRS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaggctatgcagagaagctttcttacattgaagatgtgggcaacgttggaatg
gctgaatttttcgattcacctcaaattttgcaagaaaaaattgaacaacttgccaaatta
atacagaagagcaagcatctagtggtgtttacaggtgcaggaatctcaacttcttgtggt
atacctgattttcgaggtccaaatggaatttggacactgcagcgtgagggaaaaccctta
cctgaagcttccctaccatttcatcgcgctatgccaggcatgactcacatggctttggtt
gaattagagaaggctggcattttaaagtttgttattagtcagaatgttgatggccttcat
cttcggtctggaattccaagggagaagcttgcagaattgcatgggaattccttcatggag
gcttgcccttcatgtggaagcgagtatttccgtgactttgaggtggaaacaattggatta
aaagagacatcacgacgttgctctgatctaaaatgtggagcaaaacttagggatacagtt
cttgactgggaggatgctctgccccccaaggagatgaatccagcagaaaagcactgtaaa
attgctgatgttgtactttgcctcggtactagtttgcagataactcctgcatgcaatttg
cctcttaaatgtctccgaggtgggggaaagattgtaattgtgaatcttcagaaaactccg
aaggacaagaaagcaagtttggtgatccatgggtttgtagataaggttgttgcaggagtg
atggacttgcttaatttgcggattcctccatatatcaggattgacctcttccagatcatt
gtaacacaatctttgagttcagataaaaaatttgtgaactggactcttcggataacaagt
gtacatggacaaactgctcaattgccattcatcaagtctgttgaggtttccttctcagac
aggcaaaagtacaaagaagctagtttggataagcagccatttcagctgaaaaggagaact
gttattaatgaaacatttgacatcaagttgaaactcaactttagtgatggttgtggatgt
ccttgcacccaaattaatatcccttttgattttaaggttccgcccaagtgttttgaactt
gacaaggacgacatattccaaaggctaagagagacagcatttcaagatttaggctgtggc
cagaatgaagtaattgagagaaaggtcttgtcatcccccaaaagtgaggtcacagtctat
gccattgtaagcaatgtcaaaacttttgaatccaattgtctgagtaacggcgatctgaaa
tggctaaaagatggtgtgaatggtactgaaacatccaagaagcggtcaaatagtcgtaag
cgtaaatcaagatcgtaa

DBGET integrated database retrieval system