KEGG   Citrus sinensis (Valencia orange): 102608170Help
Entry
102608170         CDS       T02983                                 

Definition
phosphoenolpyruvate carboxylase, housekeeping isozyme-like
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cit  Citrus sinensis (Valencia orange)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:cit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    102608170
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    102608170
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    102608170
Enzymes [BR:cit01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     102608170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 969 aa AA seqDB search
MAANRNLEKMASIDAQLRLLVPRKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKETVQE
CYELAAEYEGKNDPSKFKELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEELQIAHRRRI
KKLKKGDFADENSATTESDIEETFKRLVGELNKSPEEIFDALKNQTVDLVLTAHPTQSVR
RSLLQKHARIRNCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTQPTPQDEMRA
GMSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEV
TRDVCLLARMMAANLYYSQIEDLMFEMSMWRCSDELRHRADVLHRSSKKDAKHYIEFWKQ
IPPNEPYRVILGDVRDKLYQTRERVRQLLAHGISDIPEEAVFTNVEQFLEPLELCYRSLC
SCGDRAIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVIDAITKHLEIGSYREWSEE
KRQEWLLSELSGKRPLFGPDLPKTEEIADVLETFHVIAELPADNFGAYIISMATAPSDVL
AVELLQRECHVKQPLRVVPLFEKLADLEAAPAALARLFSVDWYRNRINGKQEVMIGYSDS
GKDAGRFSAAWQLYKAQEELIKVAKQYGIKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
HGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRTMMDEMAVIA
TEEYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAFKHVIQKDIRNLHMLQEMYNNWPFFRVTIDLVEMVFAKGNHKIAALY
DQLLVSKDLWSFGEKLRVNYEETKGLLLQIAGHKDLLEGDPYLKQRLRLRDAYITTLNVC
QAYTLKRIRDPNYHVKVRPHISREIMESESVKPADELVKLNLSSEYAPGLEDTLILTMKG
IAAGLQNTG
NT seq 2910 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaataggaatttagagaagatggcatcgattgatgcgcagctgaggcttctg
gttcctcgaaaagtgagtgaagatgataagttgattgagtacgatgctcttcttttggat
cggtttcttgatattcttcaggatttgcatggagaggatctcaaagaaacggttcaagag
tgttatgaacttgcagctgagtatgaaggaaagaatgatcccagcaaatttaaggagctt
ggaaatgtcttgacaagtctggatccaggggactccattgtcattgccaaagctttctcc
cacatgcttaacttggccaacttggccgaggagcttcagattgcccaccgtcgaaggatc
aaaaagttgaagaagggtgattttgctgatgagaactcggcaacaactgaatcagacatt
gaagaaacattcaagagacttgtgggagagctgaataagtctcctgaggagatttttgat
gctctgaagaatcaaactgtggatctggtcttgactgctcatcctactcaatcagtccgc
agatctttgcttcagaaacatgcaaggattcgtaattgtttagcacagttgtatgccaaa
gatattactcctgatgacaagcaggagcttgatgaggctcttcagcgagagattcaagct
gcattccgtacagatgagatccgaaggacccaaccaactccgcaagatgaaatgagagcc
ggaatgagctacttccatgaaacaatctggaagggtgtacctaaatttttgcgccgtgtt
gacacagctttgaaaaacatagggatcaatgagcgtgttccgtacaatgccccacttatt
cagttttcttcttggatgggtggtgatcgtgatggcaatccaagggtaactcctgaggtc
actagggatgtttgcctattggctagaatgatggctgctaacttgtactattcccaaatt
gaggatcttatgtttgagatgtccatgtggcgttgcagtgatgagcttcgtcatcgtgct
gacgtacttcacagatcctcaaagaaagatgcaaagcactacatagagttctggaaacaa
attcctccaaatgaaccctaccgtgtgattcttggtgatgtgagggataagctgtatcaa
acccgtgaacgtgttcgtcagctattagcccatggaatctctgatattccagaggaagca
gtattcaccaatgttgagcagttcttggaacctcttgaactctgttataggtcactctgc
tcttgcggtgaccgagcgattgctgatggaagccttctcgatttcttgaggcaagtctcc
accttcggactctcacttgtcaggcttgatatcaggcaagagtctgatcgtcatactgat
gtcatagatgccatcaccaagcacctggaaattggttcctaccgagaatggtctgaagaa
aagaggcaggaatggcttttatctgaactcagtggcaagcgtccactgtttggccctgac
cttcctaaaactgaagaaattgctgatgttttggagacatttcatgtcatagctgaactt
ccagctgataattttggagcatacatcatatcgatggcaacagcaccatctgatgtgctg
gctgttgaactcctacagcgtgaatgccatgtgaaacaaccacttagagttgttccactt
tttgagaagcttgcagatttggaggcagcacctgctgctctggcccgactcttttcagtc
gattggtacaggaatcggatcaatggtaagcaagaagtcatgattgggtactcagattct
ggtaaagatgctgggcgattctcggctgcctggcagttatacaaggctcaagaggagctt
ataaaggtagcaaagcaatatggtataaaactaaccatgttccatggtcgtggtggaact
gttggaagaggaggtggtcccacccatcttgccatattgtctcaaccaccagatacaatt
catggctcactgcgtgttactgttcaaggtgaagttattgagcagtcatttggggaggaa
cacttgtgctttagaacacttcaacgtttcacagctgcaacacttgagcatggtatgcgt
cccccaatttcaccgaaaccagaatggcgcacgatgatggatgaaatggcagttattgct
acagaggaataccgctccattgtcttcaaagaacctcgatttgttgaatatttccgattg
gctacaccagagttggagtatgggcgtatgaacattggaagccgtccatccaagcgaaag
ccaagtggcggtattgaatctcttcgtgcaatcccctggatctttgcctggacgcaaacc
agatttcatcttccagtgtggcttggttttggggctgctttcaaacatgtcattcagaag
gacattaggaatctccacatgctgcaggagatgtacaataattggccattctttagagtc
actattgatttggttgaaatggtgtttgctaagggaaaccataagatagccgcattgtat
gaccagctccttgtttctaaagacttgtggtcatttggggagaagttgagagtcaactat
gaagaaaccaagggccttcttcttcagattgctggacacaaggatcttcttgaaggagac
ccttacttgaagcaaagactccgtcttcgtgatgcatatatcactactctcaatgtgtgc
caggcctacacactgaaacggatccgtgatccaaactaccatgtgaaggtgcggccgcat
atctcaagggaaattatggaatcagaatctgtcaaacctgccgatgagctggtgaaactg
aatttgtcaagtgagtatgcccctggtttggaggataccctcatcttgacaatgaaaggt
attgctgctggcttgcagaacaccggttaa

DBGET integrated database retrieval system