KEGG   Citrus sinensis (Valencia orange): 102608219Help
Entry
102608219         CDS       T02983                                 

Definition
probable MYST-like histone acetyltransferase 1-like
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
cit  Citrus sinensis (Valencia orange)
Brite
Enzymes [BR:cit01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102608219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 449 aa AA seqDB search
MGSLETPTTTETNGSATPAVTSNGGDHKPPVTANGAPLSSTDSRIVMAQESEATKKRRAS
MLPLEVGTRVMCRWRDGKYHPVKVIERRKMHFGGPNDYEYYVHYTEFNRRLDEWVKLEQL
DLDSVETVVDEKVEDKVTSLKMTRHQKRKIDETHVEGHEELDAASLREHEEFTKVKNIAT
IELGRYEIETWYFSPFPPEYNDCLKLYFCEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIY
RSGTLSMFEVDGKKNKVYGQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGY
FSKEKHSEESYNLACILTLPPYQRKGYGKFLIAFSYELSKKEGKVGTPERPLSDLGLLSY
RGYWTRVLLDILKKHKGNISIKELSDMTAIKAEDILTTLQSLELIQYRKGQHVICADPKV
LDRHLKAAGRGGLEVDVSKLIWTPYKEQG
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgggttcgctggagacaccgacgacaacagaaaccaacggctcggcaaccccagccgtc
acatctaacggcggggatcataagcctcccgtcaccgccaacggagcgccgctttcttca
acggattccaggattgtgatggctcaggaatcggaggcgacgaaaaaacggagggcgagt
atgctgccacttgaggttggtactcgcgtcatgtgccgttggagagacggaaagtaccac
cccgtcaaagtcatcgaacgccgtaagatgcactttggtgggcccaacgattatgagtac
tatgtccattacaccgagttcaataggaggctcgatgaatgggtgaagcttgaacaactt
gatcttgattcggtagaaacagttgttgatgagaaggtagaagacaaggtaacaagctta
aaaatgacccgccatcaaaaacgaaagattgatgagacacatgttgagggtcacgaggag
cttgacgcagccagtttgcgtgagcatgaagaattcacaaaagtgaaaaacatagcaacg
atagaacttggaagatatgagatagagacatggtacttctccccttttccaccagaatac
aatgactgtttgaagctatacttttgtgagttttgtctcaatttcatgaagcgcaaagaa
cagcttcaaaggcacatgaggaagtgtgatcttaagcatccccctggcgatgagatctac
agaagtggtacattatcaatgtttgaggttgatggcaaaaagaacaaggtttatgggcag
aacctctgttatttggcaaagttgtttcttgatcacaagacactttattatgatgttgat
ctgtttctattctatgttctgtgtgagtgcgatgatcggggatgccacatggttgggtat
ttttctaaggaaaagcattcagaggaatcttacaatttggcatgtatcctcactcttcca
ccataccaaaggaagggctatggcaaatttttaattgccttttcatatgaactctccaag
aaagaaggtaaagttggcacaccagaaagacctctctcagatcttgggctgttgagttac
agaggatactggacccgggttcttctagatatcttgaagaagcacaagggcaatatatct
ataaaggagctcagcgacatgactgccatcaaggctgaggacattttgaccactctccaa
agcctggaattgattcaatacaggaaagggcagcatgttatatgtgcagatcccaaggta
ctggatcggcatctaaaagctgctggtcgtggcggtctagaggttgatgtcagcaaattg
atctggactccttacaaggagcagggctga

DBGET integrated database retrieval system